DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr78E

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:104 Identity:29/104 - (27%)
Similarity:58/104 - (55%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSILVLACLLSALCLAA--------AAPDAEIVDLVSDVNAD-SYSYKFETSDGTKQEQHGSLKS 57
            |.::|...|.:|:.|:|        ..|...|::...:.:.| ||::.:...|||.:.:...:::
  Fly     3 KILIVALSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRN 67

  Fly    58 LGPEEDALQVAGSFSFVGDDGQTHAISYVADENGFQPQG 96
            .|.|.:.|:::||:|:...:||...::|.||::||.|:|
  Fly    68 QGTENEYLEISGSYSYFDANGQEVTVTYKADDHGFVPEG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 15/54 (28%)
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.