DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr73D

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster


Alignment Length:79 Identity:22/79 - (27%)
Similarity:38/79 - (48%) Gaps:13/79 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LAAAAPDAEIVDLVSDVNADSYSYKFETSDGTKQEQHGSLKSLGPEEDALQVAGSFSFVGDDGQT 80
            |...:||..:.|...|   .|||:.|.|.|.::.|::.|         ..::.|.:|::.|.|:.
  Fly   109 LPRGSPDDPLADPFDD---PSYSFSFRTPDQSRSEENDS---------GNRIRGLYSYLDDVGER 161

  Fly    81 HAISYVADE-NGFQ 93
            |::.|.|.. .||:
  Fly   162 HSVRYAAGAGTGFE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 14/55 (25%)
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:459790 14/55 (25%)
Chitin_bind_4 <223..257 CDD:459790
SASA 491..>579 CDD:427409
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.