DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:101 Identity:35/101 - (34%)
Similarity:57/101 - (56%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVLACLLSALCLAAAAPD--AEIVDLVSDVNADS--YSYKFETSDGTKQEQHGSLKSLGPEEDA 64
            ::.::.||......:.:||  |||...|:::..:.  |:|:||||:|..|::.|    :|    .
  Fly     9 LVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG----VG----G 65

  Fly    65 LQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100
            ...:||..:...:||...::|.|||||||||||.:|
  Fly    66 YYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 19/54 (35%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.