DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr65Az

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:81 Identity:40/81 - (49%)
Similarity:54/81 - (66%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DAEIVDLVSDVNAD-SYSYKFETSDGTKQEQHGSLKSLGPEEDALQVA-GSFSFVGDDGQTHAIS 84
            |..|:.|.|.||.| ||.|::||.:|.|.|:.|.||:.|.|....|.| ||||:...:||..:::
  Fly   113 DIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLT 177

  Fly    85 YVADENGFQPQGEDIP 100
            |:||||||||||:.:|
  Fly   178 YIADENGFQPQGDHLP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 25/55 (45%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 25/55 (45%)

Return to query results.
Submit another query.