DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:66 Identity:22/66 - (33%)
Similarity:34/66 - (51%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SYSYKFETSDGTKQEQHGSLKSLGPEEDALQVA-GSFSFVGDDGQTHAISYVADENGFQPQGEDI 99
            ||..::||.:....|:.|.||......:.:.|. |.:|:...:|....:.|.||||||:..|:.|
  Fly    65 SYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATGDHI 129

  Fly   100 P 100
            |
  Fly   130 P 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 16/55 (29%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 16/55 (29%)

Return to query results.
Submit another query.