powered by:
Protein Alignment Lcp65Aa and Cpr49Ah
DIOPT Version :8
Sequence 1: | NP_477280.1 |
Gene: | Lcp65Aa / 38709 |
FlyBaseID: | FBgn0020645 |
Length: | 102 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610777.1 |
Gene: | Cpr49Ah / 36354 |
FlyBaseID: | FBgn0033731 |
Length: | 190 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 22/66 - (33%) |
Similarity: | 34/66 - (51%) |
Gaps: | 1/66 - (1%) |
Fly 36 SYSYKFETSDGTKQEQHGSLKSLGPEEDALQVA-GSFSFVGDDGQTHAISYVADENGFQPQGEDI 99
||..::||.:....|:.|.||......:.:.|. |.:|:...:|....:.|.||||||:..|:.|
Fly 65 SYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATGDHI 129
Fly 100 P 100
|
Fly 130 P 130
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR10380 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.