DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr47Eg

DIOPT Version :8

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster

Alignment Length:93 Identity:29/93 - (31%)
Similarity:44/93 - (47%) Gaps:8/93 - (8%)


  Fly     1 MKSILVLACLLSALCLAAAAPDAEIVDLVSDVNADSYSYKFETSDGTKQEQHGSLKSLGPEEDAL 65
            ||..:..||||:   :|.|..||.::.....||.|.::|..|..:....:|.|.|..     :..
  Fly     1 MKFFIAFACLLA---VALANEDANVLRAEQQVNVDGFAYAVELDNSVNVQQKGDLNG-----EEW 57

  Fly    66 QVAGSFSFVGDDGQTHAISYVADENGFQ 93
            .|.||.|:...:....:|.|:||.||:|
  Fly    58 VVKGSQSWTSPENVPVSIQYIADANGYQ 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:278791 14/54 (26%)
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.