DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr47Ec

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:101 Identity:31/101 - (30%)
Similarity:53/101 - (52%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVLACLLSALCLAAAAPDAE---IVDLVSDV--NADSYSYKFETSDGTKQEQHGSLKSLGPEED 63
            :.|||.:::  |..|...|.|   :..|.|::  ..:.|:..:..:||..:.:...|...|.:|:
  Fly     7 LFVLAVMVA--CGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDEE 69

  Fly    64 ALQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDI 99
            ||:|.||:.::.:|||...:.|.|.:|||.|.|..|
  Fly    70 ALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYGSII 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 17/54 (31%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.