DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Lcp2

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:107 Identity:31/107 - (28%)
Similarity:53/107 - (49%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSILVLACLLSALCLAAAAPD----AEIVDLVSDVNADSYSYKFETSDGTKQ----EQHGSLKSL 58
            |.:::||.:..|..||..:..    |:::....||.||.:.....||:|.:|    :.||:    
  Fly     3 KFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSNGIEQAASGDAHGN---- 63

  Fly    59 GPEEDALQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100
                    :.|:|.::..:|:...:.|||:|||:||.|..||
  Fly    64 --------IHGNFGWISPEGEHVEVKYVANENGYQPSGAWIP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 14/58 (24%)
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 14/58 (24%)

Return to query results.
Submit another query.