DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr12A

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:112 Identity:35/112 - (31%)
Similarity:56/112 - (50%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILVLACLLSALCLAA-----AAPDAEIVDLVSDVNAD-SYSYKFETSDGTKQEQHGSLKSLGPE 61
            |||....||||..::|     :||.|.::|...:...| ||.|:||..|||.:.:.|....:. :
  Fly     6 SILFAIFLLSATLISAQQIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKIN-D 69

  Fly    62 EDALQVAGSFSFVGDDGQTHAISYVADENGFQ------PQGEDIPHL 102
            ...|.|.|.:::...||:...:.|.||:.|::      ||  :.|:|
  Fly    70 VKTLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITPQ--EYPNL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 16/54 (30%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 16/54 (30%)

Return to query results.
Submit another query.