DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and CG15756

DIOPT Version :8

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster

Alignment Length:90 Identity:15/90 - (16%)
Similarity:35/90 - (38%) Gaps:15/90 - (16%)


  Fly    25 IVDLVSDVNAD-SYSYKFETSDGTKQEQHGSLKSLGPEEDALQVAGSFSFVGDDGQTHAISYVAD 88
            :||.....:.| .|.::::..:|..:.:......:| ::..|...|.:|....:.:...:.|.||
  Fly    95 LVDSFDQRSLDGQYEFRYQLDNGNTRYERAYWLPVG-KDLVLAKKGYYSVPLPNDKYSTVFYTAD 158

  Fly    89 ENGFQ-------------PQGEDIP 100
            ..|:.             |:..::|
  Fly   159 HRGYHVDMQTLSVEQPLLPRSLEVP 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:278791 9/54 (17%)
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 9/54 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.