DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:105 Identity:39/105 - (37%)
Similarity:57/105 - (54%) Gaps:11/105 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFLIVFVALFAVA-LAAPAAEEPTIVRS-ESDVGPE-SFKYDWETSDGQAAQAVGQLNDIGTENE 63
            ||.::.||..||: :.|.:.:.....|. :||:..: |:.|.::||:|.|    ||.:.:|    
  Fly     3 KFFVLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIA----GQESGVG---- 59

  Fly    64 AISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAP 103
            ....|||..:.|.|||..|:.|.||.||:.|.|||||..|
  Fly    60 GYYASGSNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTPP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 20/54 (37%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.