DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and Cpr47Ef

DIOPT Version :10

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:91 Identity:34/91 - (37%)
Similarity:52/91 - (57%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AAPAAEEPTIVRS---ESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIADD 77
            |.|.:..|..:.|   |:| |..::::.:||.:|..||..|.:.:.|:|||..||.|||.:...:
  Fly   126 APPTSGPPIPILSFVNEND-GDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSYSYTNPE 189

  Fly    78 GQTYQVNYIADKNGFQPQGAHLPVAP 103
            |:..::.|.||:|||.|.|..||..|
  Fly   190 GELVEIMYTADENGFVPSGNALPTPP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 20/54 (37%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.