DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and Lcp4

DIOPT Version :10

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:101 Identity:32/101 - (31%)
Similarity:51/101 - (50%) Gaps:10/101 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAISV 67
            |.|:.|... |||.| |.|.|.:....:||..:.|.......:|.||.|.|.::.        ::
  Fly     2 FKILLVCAL-VALVA-ANENPEVKELVNDVQADGFVSKLVLDNGSAASATGDVHG--------NI 56

  Fly    68 SGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAP 103
            .|.:.:::.:|:..:|:|.||:||:|||...||..|
  Fly    57 DGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPP 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 13/54 (24%)
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 12/48 (25%)

Return to query results.
Submit another query.