DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and Lcp2

DIOPT Version :10

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:106 Identity:29/106 - (27%)
Similarity:52/106 - (49%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFLIVFVALFAVALAAPAAEEPTI---VRSES-DVGPESFKYDWETSDGQAAQAVGQLNDIGTEN 62
            ||:::...:......||.:....:   |.|.| ||..:.|.....||:|....|.|..:.     
  Fly     3 KFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSNGIEQAASGDAHG----- 62

  Fly    63 EAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAP 103
               ::.|::.:|:.:|:..:|.|:|::||:||.||.:|..|
  Fly    63 ---NIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 13/54 (24%)
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.