DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and CG15754

DIOPT Version :10

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster


Alignment Length:103 Identity:26/103 - (25%)
Similarity:35/103 - (33%) Gaps:29/103 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAAEEPTIVRSESDVGPESFKYDWETSDGQA-AQAVGQLNDIGT--------------------- 60
            ||..:|..|..|...|    :.|.|..|..| .....:||:.|:                     
  Fly   158 PALPQPGGVLEELAGG----QVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRRWEKGYYSE 218

  Fly    61 ENEAISVSGSYRFIADDGQ--TYQVN-YIADKNGFQPQ 95
            |.....|.|.|.....|.|  .|::. |.||..|:||:
  Fly   219 EQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEGYQPR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 17/79 (22%)
CG15754NP_572894.1 None

Return to query results.
Submit another query.