DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and LOC1276149

DIOPT Version :10

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_315459.4 Gene:LOC1276149 / 1276149 VectorBaseID:AGAMI1_000569 Length:137 Species:Anopheles gambiae


Alignment Length:100 Identity:49/100 - (49%)
Similarity:63/100 - (63%) Gaps:10/100 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIVFVALFAVALAA-PAAEEPTIVRSESDVGPE-SFKYDWETSDGQAAQAVGQLNDIGTENEAIS 66
            |.|..||.|||.|. |...:..::.|:|.|.|: |:.|.:|||:|.|||..|    :|.:    |
Mosquito     4 LFVIAALVAVAAAQNPQDAQAQVLASDSVVNPDGSYNYRYETSNGLAAQESG----VGGQ----S 60

  Fly    67 VSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPV 101
            ..|||.:..|||..|||:|:||:||||||||||||
Mosquito    61 AQGSYSYTGDDGVQYQVSYVADENGFQPQGAHLPV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 24/54 (44%)
LOC1276149XP_315459.4 Chitin_bind_4 39..86 CDD:459790 24/54 (44%)

Return to query results.
Submit another query.