DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbn and Cpr97Ea

Sequence 1:NP_729143.2 Gene:l(3)mbn FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster

Alignment Length:444 Identity:82/445 (18%)
Similarity:115/445 (26%) Gaps:207/445 (47%)


  Fly    31 YKFGFTIDEQQHRAEKRDERGIIMGEFGFITADGIYHVTVYATDEEGKFRIISMKSYPYA-GPVG 94
            |.:|:...:...:.|.:...|.:.|::|::             ||.||.|::...:..|. .|.|
  Fly    72 YTYGYEGADGSFKIETKLATGEVKGKYGYV-------------DETGKVRVVEYGANKYGFQPSG 123

  Fly    95 SKSVPVTTTPKVLLPAAPVALPKYNFNSEACSGCFLKKSPPKTEIRTLSQPLAPVQPGKPDGSSD 159
            .   .:|..|..|:...                  ||:.|...:     :| ||.:|.||     
  Fly   124 E---GITVAPPTLVDET------------------LKEEPDYAD-----EP-APQRPQKP----- 156

  Fly   160 IGLNVQLPFRESIAQTVASRLGLLQDTLQTSNTNTNAPNTKTIELGLNIAMSTYYTTKNAVTGHV 224
              ..||.|                                                         
  Fly   157 --YRVQRP--------------------------------------------------------- 162

  Fly   225 STQTSNSQTPSANTKIDYNVGVVEKASPPVYRPLNIRLNEDVMRQAITYGNTIPGHVPLPNQPLV 289
              |......|....:..|....||:.||                :.:.|.   |...|.| |||.
  Fly   163 --QPRPQPRPQPQPQPQYVQYEVEEESP----------------RRVQYA---PAPQPQP-QPLP 205

  Fly   290 ETSLLPASQVKIFALDGNAKVPLASNIQSVAQH--PNAG---LNAKVPLASNIQSVAQHPNAGLN 349
            :...||                        .||  |:.|   ...:||.|.....|...|.....
  Fly   206 QPQHLP------------------------QQHHQPSVGPAPPRLQVPGAQRTTDVLYSPLQRPA 246

  Fly   350 AKVPLASNIQSVAQHPNAGLKNINRSGVSSAKTLANTKTRPPHTFNPHQTPLLSSATAPGISGVT 414
            ...|..|..||....|:    |:..|             ||.:.. |..:|..|||.|.|..   
  Fly   247 RPEPDYSQTQSFGDGPS----NVRIS-------------RPVYAL-PPASPAPSSARAQGFL--- 290

  Fly   415 ANTPTGNVPSNGG-------GIAAGKAPG--------------NPQA--GGSGG 445
                   .|::||       |....:.|.              .|||  ||.||
  Fly   291 -------APASGGRPLLEPVGFGQSQGPSARPVQQQPSFQPQPRPQARSGGGGG 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791 8/46 (17%)
Chitin_bind_4 575..621 CDD:278791
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 12/60 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.