DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbn and Cpr78Cc

Sequence 1:NP_729143.2 Gene:l(3)mbn FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster

Alignment Length:37 Identity:15/38 (39%)
Similarity:21/38 (55%) Gaps:1/38 (3%)


  Fly   587 EETGGRNGDKQGSYFAIGEDAVQRTIEYIANEFGFQP 623
            :|.|..|| ..||...|..:.|..::.|:|:|.||||
  Fly    55 QEAGNVNG-ISGSSSYISPEGVPISLTYVADENGFQP 90

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791
Chitin_bind_4 575..621 CDD:278791 12/34 (35%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.