powered by:
Protein Alignment l(3)mbn and Cpr78Cc
DIOPT Version :9
| Sequence 1: | NP_729143.2 |
Gene: | l(3)mbn / 38701 |
FlyBaseID: | FBgn0002440 |
Length: | 653 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_649300.1 |
Gene: | Cpr78Cc / 40355 |
FlyBaseID: | FBgn0037069 |
Length: | 119 |
Species: | Drosophila melanogaster |
| Alignment Length: | 37 |
Identity: | 15/37 - (40%) |
| Similarity: | 21/37 - (56%) |
Gaps: | 1/37 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 587 EETGGRNGDKQGSYFAIGEDAVQRTIEYIANEFGFQP 623
:|.|..|| ..||...|..:.|..::.|:|:|.||||
Fly 55 QEAGNVNG-ISGSSSYISPEGVPISLTYVADENGFQP 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.