DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbn and Cpr67Fa1

Sequence 1:NP_729143.2 Gene:l(3)mbn FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_648418.1 Gene:Cpr67Fa1 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster

Alignment Length:127 Identity:30/128 (23%)
Similarity:50/128 (39%) Gaps:33/128 (26%)


  Fly   492 GGATGSKASGFGFGSNIGGGVSGSKPSGFGSESKIGGPDSGSKALGFGSGSKIGGGITGTKASGF 556
            |.||.::.:| .:.:.||..:   :|.|                 .:....:...|| ..:.||.
  Fly    17 GAATYNQEAG-AYITKIGSDI---QPEG-----------------NYNYQYETSNGI-AAQESGI 59

  Fly   557 GGEIGSGRGSASSATGDLYKFKYILDYNGHEETGGRNGDKQGSYFAIGED---AVQRTIEYI 615
            ||...:|..|..|..|:|.:..|:.|.||::        .||:.......   |:.|::|||
  Fly    60 GGNHANGGFSWYSPEGELVQISYVADENGYQ--------PQGALLPTPPPIPAAILRSLEYI 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791
Chitin_bind_4 575..621 CDD:278791 11/45 (24%)
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.