powered by:
                   
 
    
    
             
          
            Protein Alignment l(3)mbn and Cpr65Eb
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_729143.2 | Gene: | l(3)mbn / 38701 | FlyBaseID: | FBgn0002440 | Length: | 653 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_648076.3 | Gene: | Cpr65Eb / 38774 | FlyBaseID: | FBgn0035736 | Length: | 179 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 132 | Identity: | 27/132 - (20%) | 
          
            | Similarity: | 45/132 -  (34%) | Gaps: | 40/132 - (30%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly   529 PDSGSKALGFGSGSKIGGGI----------TGTKASGFGGEIGSGRGSASSATGDLYKFKYILDY 583||:.::...|.:..|...||          ...:..|.||...||.....:..|.|.:..|..|.
 Fly    26 PDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGGYYASGSSQYYTPEGQLIQLTYTADE 90
 
 
  Fly   584 NGHEETGGRNGDKQGSYFAIGE---DAVQRTIEYIANEFGFQPHVSWRKLDAKEALPEEN-SLKH 644||.:        .||.:.....   :|:.:::||..|.                  |||: ..:|
 Fly    91 NGFQ--------PQGEHLPTPHPIPEAILKSLEYNRNH------------------PEEDGEYEH 129
 
 
  Fly   645 YE 646::
 Fly   130 HD 131
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR10380 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 1.100 |  | 
        
      
           
             Return to query results.
             Submit another query.