DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbn and Cpr65Eb

Sequence 1:NP_729143.2 Gene:l(3)mbn FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster

Alignment Length:132 Identity:27/133 (20%)
Similarity:45/133 (34%) Gaps:40/133 (30%)


  Fly   529 PDSGSKALGFGSGSKIGGGI----------TGTKASGFGGEIGSGRGSASSATGDLYKFKYILDY 583
            ||:.::...|.:..|...||          ...:..|.||...||.....:..|.|.:..|..|.
  Fly    26 PDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGGYYASGSSQYYTPEGQLIQLTYTADE 90

  Fly   584 NGHEETGGRNGDKQGSYFAIGE---DAVQRTIEYIANEFGFQPHVSWRKLDAKEALPEEN-SLKH 644
            ||.:        .||.:.....   :|:.:::||..|.                  |||: ..:|
  Fly    91 NGFQ--------PQGEHLPTPHPIPEAILKSLEYNRNH------------------PEEDGEYEH 129

  Fly   645 YE 646
            ::
  Fly   130 HD 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791
Chitin_bind_4 575..621 CDD:278791 10/49 (20%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.