powered by:
Protein Alignment l(3)mbn and Lcp65Ad
DIOPT Version :9
Sequence 1: | NP_729143.2 |
Gene: | l(3)mbn / 38701 |
FlyBaseID: | FBgn0002440 |
Length: | 653 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001261466.1 |
Gene: | Lcp65Ad / 38707 |
FlyBaseID: | FBgn0020641 |
Length: | 108 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 21/58 - (36%) |
Similarity: | 31/58 - (53%) |
Gaps: | 9/58 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 575 YKFKY-ILDYNGHEETG-----GRNGDK---QGSYFAIGEDAVQRTIEYIANEFGFQP 623
|||.. ..|...|:|.| |.:.:. :|||..:|:|....:|:|:|:|.||||
Fly 41 YKFAVETSDGKSHQEEGQLKDVGTDHEAIVVRGSYAYVGDDGQTYSIQYLADENGFQP 98
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.