DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbn and Lcp65Ag1

DIOPT Version :9

Sequence 1:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster
Sequence 2:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster


Alignment Length:113 Identity:27/113 - (23%)
Similarity:40/113 - (35%) Gaps:39/113 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 SGSKPSGFGSESKIGGPDSGSKALGFGSGSKIGGGITGTKASGFGGEIGSGRGSASSATGDLYKF 577
            :..:|:...|||.: ||:|                        |..:..:..|.|:.|.|.|   
  Fly    19 AAEEPTIVRSESDV-GPES------------------------FKYDWETSDGQAAQAVGQL--- 55

  Fly   578 KYILDYNGHEETGGRNG--DKQGSYFAIGEDAVQRTIEYIANEFGFQP 623
                     .:.|..|.  ...|||..|.:|.....:.|||::.||||
  Fly    56 ---------NDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791
Chitin_bind_4 575..621 CDD:278791 10/47 (21%)
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:306811 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.