DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: loj and eca

Sequence 1:NP_648027.3 Gene:loj FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_788616.1 Gene:eca FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster

Alignment Length:242 Identity:51/243 (21%)
Similarity:92/243 (38%) Gaps:48/243 (20%)


  Fly     7 RDQINLVLPIALICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFY 71
            |||.   :.:|||.|.|                   ..|.....||...:..|:.:.|....|..
  Fly     2 RDQF---ISLALILCVL-------------------HSACGLYFHISETERKCFIEEVPDETTVI 44

  Fly    72 VSFSVVRGGDGMAGF-----------AVRNPAGEVV--KPYQWQATADYTDQVSPGGYYSVCIDN 123
            |::.|........||           .||:...::|  :.|..|....:|.. :||.:......|
  Fly    45 VNYKVELYDPRSNGFMPSSPGIGMHVEVRDSDDKIVLSRVYSSQGRISFTSH-TPGEHVICMFSN 108

  Fly   124 QFSRFAGKLVNIYITVVKYDAWDKYA-----KEIEQLQLNMQNFTATVGTVERNINDMMGYQAHS 183
            ..:.|:|..:.:::.:...:....||     :::.:|||.::.....|..:.:..|    ||   
  Fly   109 STAWFSGAQLRVHLDIQVGEHAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQN----YQ--- 166

  Fly   184 RHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVK 230
            |:||.|........|:.:..:|::|.||::.....|:..::..||.|
  Fly   167 RYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWQMRHLKSFFEAK 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 40/199 (20%)
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 40/199 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120930147
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22811
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.