DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and tmed5

DIOPT Version :8

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_956697.1 Gene:tmed5 / 393374 ZFINID:ZDB-GENE-040426-1302 Length:225 Species:Danio rerio

Alignment Length:247 Identity:55/248 (22%)
Similarity:114/248 (46%) Gaps:36/248 (15%)


  Fly     3 LTWQRDQINLVLPIALICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAG 67
            :.|..:    ||...:.|..:.:.:.||      :.::|.:   |:...:.||:.:|:.|.:|..
Zfish     1 MRWSME----VLRACVACLSVCVSLASA------FSQSLDS---DFTFTLAAGRRECFFQTMKKD 52

  Fly    68 ATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATADY--TDQV----SPGGYYSVCIDNQFS 126
            |:..:.:.|:.|......|.:.:|:|.::       .:||  :|.|    :..|.|..|.||.||
Zfish    53 ASLEIEYQVLDGASLDVDFQLNSPSGHII-------ASDYRKSDGVHTVETEEGDYMFCFDNTFS 110

  Fly   127 RFAGKLVNIYITVV--------KYDAWDKYAKEIEQLQLNMQNFTATVGTVERNINDMMGYQAHS 183
            ..:.|:  |:..::        :.:.|..|.:..:.|.:.:::...|:..|:..:...:..|...
Zfish   111 AVSEKV--IFFELILDNMGEDEESEDWKAYVQGADLLDMKLEDIMDTINNVKSRLGKSLQIQTLL 173

  Fly   184 RHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVKSSSKS 235
            |..|:||..|...|...:..:|.:.::|::|...|||:.:|.|||.|:.:::
Zfish   174 RAFEARDRNLQESNYERVNLWSCTNVLVMVIVSGVQVYLLRSLFEDKTKTRT 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 46/195 (24%)
tmed5NP_956697.1 EMP24_GP25L 32..218 CDD:279450 46/195 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.