DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and TMED1

DIOPT Version :10

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_006849.1 Gene:TMED1 / 11018 HGNCID:17291 Length:227 Species:Homo sapiens


Alignment Length:188 Identity:43/188 - (22%)
Similarity:88/188 - (46%) Gaps:12/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IDAGKEDCYHQYVKAGATFYVSFSVVRGGDGM-AGFAVRNPAGEVVKPYQWQATADYTDQVSPGG 115
            :.||::.|::|...|.|:....:.|: ||.|: ..|.:.:|.|.::.....:|...:|.:.:..|
Human    38 LPAGRKQCFYQSAPANASLETEYQVI-GGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAG 101

  Fly   116 YYSVCIDNQFSRFAGKLVNIYITVV--------KYDAWDKYAKEIEQLQLNMQNFTATVGTVERN 172
            .|.:|.||.||..:.|||  :..::        :.:.|.:..:..|.|.:.|::...::.|:...
Human   102 DYKLCFDNSFSTISEKLV--FFELIFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTR 164

  Fly   173 INDMMGYQAHSRHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVK 230
            :...:......|..|:||..|...|...:..:|...:.|:|:...:||..:::.|:.|
Human   165 LERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVLQVCTLKRFFQDK 222

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:426051 41/184 (22%)
TMED1NP_006849.1 EMP24_GP25L 33..220 CDD:426051 41/184 (22%)
COPI vesicle coat-binding. /evidence=ECO:0000255 218..227 2/5 (40%)