DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loj and TMED1

DIOPT Version :8

Sequence 1:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_006849.1 Gene:TMED1 / 11018 HGNCID:17291 Length:227 Species:Homo sapiens

Alignment Length:188 Identity:43/189 (23%)
Similarity:88/189 (47%) Gaps:12/189 (6%)


  Fly    52 IDAGKEDCYHQYVKAGATFYVSFSVVRGGDGM-AGFAVRNPAGEVVKPYQWQATADYTDQVSPGG 115
            :.||::.|::|...|.|:....:.|: ||.|: ..|.:.:|.|.::.....:|...:|.:.:..|
Human    38 LPAGRKQCFYQSAPANASLETEYQVI-GGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAG 101

  Fly   116 YYSVCIDNQFSRFAGKLVNIYITVV--------KYDAWDKYAKEIEQLQLNMQNFTATVGTVERN 172
            .|.:|.||.||..:.|||  :..::        :.:.|.:..:..|.|.:.|::...::.|:...
Human   102 DYKLCFDNSFSTISEKLV--FFELIFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTR 164

  Fly   173 INDMMGYQAHSRHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVK 230
            :...:......|..|:||..|...|...:..:|...:.|:|:...:||..:::.|:.|
Human   165 LERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVLQVCTLKRFFQDK 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 42/185 (23%)
TMED1NP_006849.1 EMP24_GP25L 33..220 CDD:307313 42/185 (23%)
COPI vesicle coat-binding. {ECO:0000255} 218..227 2/6 (33%)
COPII vesicle coat-binding. {ECO:0000255} 218..219 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.