DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Jon99Fii

DIOPT Version :10

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:105 Identity:28/105 - (26%)
Similarity:40/105 - (38%) Gaps:36/105 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CHRLKTTKRKGWINQGINGPESIADHMYRMALMALIAGDLTGVDRERCIKMAIVHDIAEAIVGDI 146
            |..|||.|..    .|..|.:.|.    |.|       |:.|:|         :.|:.       
  Fly   470 CSSLKTGKTP----PGTPGRKKIV----RFA-------DVLGLD---------LTDVR------- 503

  Fly   147 TPSDGVPKEEKSRRE-----TAALKEMCEVLGGGLRAEEI 181
            |..|.|||..:|..|     |||.:.|.|::..|.:|:.:
  Fly   504 TFMDEVPKVPQSAYEDLTIVTAAEQPMPEIISLGPKADRV 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 28/105 (27%)
Jon99FiiNP_651799.1 Tryp_SPc 38..262 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.