DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CELA2A

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:278 Identity:93/278 - (33%)
Similarity:140/278 - (50%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWW-- 67
            ::..|.|::..||.|....|.:|      |.:| |:..|::|....:|:||.|.:||: |.|:  
Human     1 MIRTLLLSTLVAGALSCGDPTYP------PYVT-RVVGGEEARPNSWPWQVSLQYSSN-GKWYHT 57

  Fly    68 CGGSIIGNEWVLTAAHCTDGAASVTIYYGA-TVRTSPEFTQVVSSSKFRQHESYLALTIR--NDI 129
            ||||:|.|.||||||||...:.:..:..|. .:..:...:..||.||...|:.:.:..|.  |||
Human    58 CGGSLIANSWVLTAAHCISSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDI 122

  Fly   130 SLIQTSS-VSFSATVNKISLP----AVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTI 189
            :|::.:: ||.:..:....||    .:.|:|..|      .:|||...... ||...||...|.:
Human   123 ALLKLANPVSLTDKIQLACLPPAGTILPNNYPCY------VTGWGRLQTNG-AVPDVLQQGRLLV 180

  Fly   190 ISNSKCQET--FGSLIVTSRVLCVDTTNKASTCQGDSGGPL---ALDG--VLIGATSFGSADGCE 247
            :..:.|..:  :||.:.|| ::|.......|:|.|||||||   |.||  .:.|..||||..||.
Human   181 VDYATCSSSAWWGSSVKTS-MICAGGDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCN 244

  Fly   248 -SGAPAAFTRITYYRDWI 264
             ...|:.|||::.|.|||
Human   245 YYHKPSVFTRVSNYIDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 82/242 (34%)
Tryp_SPc 40..267 CDD:238113 83/243 (34%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 83/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.