DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and AgaP_AGAP010015

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_001238092.2 Gene:AgaP_AGAP010015 / 4577984 VectorBaseID:AGAP010015 Length:239 Species:Anopheles gambiae


Alignment Length:255 Identity:70/255 - (27%)
Similarity:102/255 - (40%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTD-GAASVTIYYGAT-- 98
            :|||.||......::|:.|.:.|..   .:.|.|:||....||:..:|.: ....::||.|.|  
Mosquito     7 SGRILNGLKVNPERYPFIVNIYFED---QFLCSGNIITPSHVLSLEYCFEIFVFQMSIYGGGTSP 68

  Fly    99 -----------VRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQTSSVSFSATVNKISLPAVS 152
                       :...|.|......|.|             |:::|.....:|....|..|: |:.
Mosquito    69 LSGGISIPVNKITIHPNFEYRYGRSDF-------------DVAVISVPINTFQGMANMASI-ALQ 119

  Fly   153 NSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSL--IVTSRVLCVDTTN 215
            .| ....|......|||::..........|.|..:.|:|.|.|..::.|:  .|||.::|.....
Mosquito   120 TS-EVLPGSRCYVIGWGVSKIFGPIDLNGLHYGTMNIVSQSACSRSWASVNENVTSNMICAKYCF 183

  Fly   216 KASTCQGDSGGPLALDGVL---IGATSFGSADGCESGAPAAFTRI--TYYRDWIKETSGI 270
            ....|.||.||||..||.|   ||.|.:    ||....||.||||  ...|.:|:..:||
Mosquito   184 GVDICYGDLGGPLVCDGKLTGIIGYTEY----GCTKNNPAVFTRIMAPSIRSFIRNETGI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 66/245 (27%)
Tryp_SPc 40..267 CDD:238113 66/247 (27%)
AgaP_AGAP010015XP_001238092.2 Tryp_SPc 9..224 CDD:214473 63/236 (27%)
Tryp_SPc 10..235 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.