DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:253 Identity:87/253 - (34%)
Similarity:125/253 - (49%) Gaps:32/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SITGRITNGKD-AVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHC-------TDGAASV 91
            |.|.||..|:: |:.|::|:|..|....|...  ||.|:|.|.|:||||||       |...|: 
Human   201 SSTQRIVQGRETAMEGEWPWQASLQLIGSGHQ--CGASLISNTWLLTAAHCFWKNKDPTQWIAT- 262

  Fly    92 TIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSY 155
               :|||: |.|...:.|  .|...||:|...|..|||:|:|.|: |.||..|.::.||   :|.
Human   263 ---FGATI-TPPAVKRNV--RKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLP---DSS 318

  Fly   156 STYEGKTAV-ASGWGLTSDQATAVSRDLQYVDLTIISNSKC--QETFGSLIVTSRVLCVD-TTNK 216
            .....||:| .:|:|...|.. .:...|:...:..||...|  ::.:..|| |..:||.. ...|
Human   319 IKLPPKTSVFVTGFGSIVDDG-PIQNTLRQARVETISTDVCNRKDVYDGLI-TPGMLCAGFMEGK 381

  Fly   217 ASTCQGDSGGPLALDG----VLIGATSFGSADGCESGAPAAFTRITYYRDWIKETSGI 270
            ...|:|||||||..|.    .::|..|:|.:..... .|..:||:|.|||||...:|:
Human   382 IDACKGDSGGPLVYDNHDIWYIVGIVSWGQSCALPK-KPGVYTRVTKYRDWIASKTGM 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 82/241 (34%)
Tryp_SPc 40..267 CDD:238113 83/243 (34%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699
Tryp_SPc 205..432 CDD:214473 82/241 (34%)
Tryp_SPc 206..435 CDD:238113 83/243 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.