DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Prss2

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:273 Identity:89/273 - (32%)
Similarity:135/273 - (49%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGG 70
            :|:|||..|:...     ||...|:     |.|..|..:.:|    ||||.|    :||..:|||
Mouse     4 LLILALVGAAVAF-----PVDDDDK-----IVGGYTCRESSV----PYQVSL----NAGYHFCGG 50

  Fly    71 SIIGNEWVLTAAHCTD-------GAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRND 128
            |:|.::||::||||..       |..::.:..|.        .|.|.|:|..:|.:|.:.|:.||
Mouse    51 SLINDQWVVSAAHCYKYRIQVRLGEHNINVLEGN--------EQFVDSAKIIRHPNYNSWTLDND 107

  Fly   129 ISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISN 192
            |.||:.:| |:.:|.|..:.||    |.....|...:.||||.|..........||.||..::..
Mouse   108 IMLIKLASPVTLNARVASVPLP----SSCAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQ 168

  Fly   193 SKCQETF-GSLIVTSRVLCVD-TTNKASTCQGDSGGPLALDGVLIGATSFGSADGC-ESGAPAAF 254
            :.|:.:: |.  :|:.::||. ......:||||||||:..:|.|.|..|:|.  || :..||..:
Mouse   169 ADCEASYPGD--ITNNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGY--GCAQPDAPGVY 229

  Fly   255 TRITYYRDWIKET 267
            |::..|.|||:.|
Mouse   230 TKVCNYVDWIQNT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 76/235 (32%)
Tryp_SPc 40..267 CDD:238113 78/237 (33%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 78/244 (32%)
Tryp_SPc 24..242 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.