DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and AgaP_AGAP004566

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_313869.5 Gene:AgaP_AGAP004566 / 1274708 VectorBaseID:AGAP004566 Length:327 Species:Anopheles gambiae


Alignment Length:276 Identity:83/276 - (30%)
Similarity:139/276 - (50%) Gaps:27/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LASASAGLLPNIAPVH--PRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSII 73
            :.|.|.....|:.|..  |..:....:...||..|::....|:|:...|.:|   |:::||||:|
Mosquito    52 IGSTSTPAPENLTPPDSCPMCKCGRTNRLTRIVGGQETQVNQYPWMAMLQYS---GTFYCGGSLI 113

  Fly    74 GNEWVLTAAHCTDG----AASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQT 134
            .:..|||||||..|    ..||.:.....|.||...|.|....:..:|..|.:....:||::::.
Mosquito   114 SDRHVLTAAHCVHGFNRNKISVVLMEHDRVSTSESMTMVSKVLRVIEHNGYNSNNYNSDIAILRL 178

  Fly   135 SSV-SFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQET 198
            ::| :....:..:.||.....::.|:|   :.:|||.||:.. |:|.:||.|.:.|:||:.|::|
Mosquito   179 ATVMTIEDKLRPVCLPTPKKPFTGYDG---IVTGWGATSENG-AISTNLQEVTVPIMSNADCRKT 239

  Fly   199 -FGSLIVTSRVLCVD-TTNKASTCQGDSGGPL------ALDGV--LIGATSFGSADGC-ESGAPA 252
             :|:..:|..:||.. ...|..:|||||||||      :.|.|  :.|..|:|  :|| :...|.
Mosquito   240 GYGASRITDNMLCAGYDEGKKDSCQGDSGGPLHVIKQNSTDNVHQIAGIVSWG--EGCAKPNYPG 302

  Fly   253 AFTRITYYRDWIKETS 268
            .:||:..:..||:..:
Mosquito   303 VYTRVNRFGTWIRSNT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 76/240 (32%)
Tryp_SPc 40..267 CDD:238113 77/242 (32%)
AgaP_AGAP004566XP_313869.5 Tryp_SPc 82..314 CDD:214473 76/240 (32%)
Tryp_SPc 83..317 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.