DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CLIPC3

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_313589.2 Gene:CLIPC3 / 1274461 VectorBaseID:AGAP004318 Length:393 Species:Anopheles gambiae


Alignment Length:292 Identity:85/292 - (29%)
Similarity:126/292 - (43%) Gaps:58/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAG--SWWCGGSI 72
            ::|.::..|.|.:..:   |......:...|..|.....|:||:...:.:....|  |:.||||:
Mosquito   119 SVAISALTLNPTLVKI---DVPKCEMVVKLIVGGNVTKPGEFPHMAAIGWRQPNGGYSFDCGGSL 180

  Fly    73 IGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQH-----ESYLALTI------- 125
            |...:|||||||...:|..|:         |...::...|..|:.     |:|..|..       
Mosquito   181 ISEYYVLTAAHCYAESADGTL---------PSIVRLGEQSLVREDDGAEPENYDILRFIVHPDLK 236

  Fly   126 -----RNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQY 184
                 .|||:||| |..|.|:..:.    ||..........:||:|:|:|.| :...|.|.:|:.
Mosquito   237 RSVGKYNDIALIQLTERVIFTNFIR----PACLYPSEVLNVRTAIATGFGRT-EYLGAKSDELRK 296

  Fly   185 VDLTIISNSKCQETF--------GSLIVTSRVLCV-DTTNKASTCQGDSGGPLALD-------GV 233
            |.|.|.:|..|.|.:        |   :.|..:|| |......||||||||||.:.       ..
Mosquito   297 VALNIYNNELCAERYRYDRHLRQG---ILSTQMCVGDLAGGKDTCQGDSGGPLQVTVQENHCMFY 358

  Fly   234 LIGATSFGSADGCESGAPAAFTRITYYRDWIK 265
            ::|.||.|..  |.|..||.:|::..|.|||:
Mosquito   359 ILGVTSLGQV--CGSSTPAIYTKVHPYLDWIE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 79/260 (30%)
Tryp_SPc 40..267 CDD:238113 81/262 (31%)
CLIPC3XP_313589.2 Tryp_SPc 146..390 CDD:238113 81/262 (31%)
Tryp_SPc 146..387 CDD:214473 79/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.