DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and AgaP_AGAP012670

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_307656.4 Gene:AgaP_AGAP012670 / 1269074 VectorBaseID:AGAP012670 Length:267 Species:Anopheles gambiae


Alignment Length:280 Identity:83/280 - (29%)
Similarity:117/280 - (41%) Gaps:23/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            ||....|||......:.:|.:.:..:..|..|.   :|||.|||.....::.|.:.|..:   |.
Mosquito     1 MKQVTSLVLFGLFCGSAVLTDASDQNKPDAASQ---SGRIVNGKAVSIVKYKYALSLRVN---GV 59

  Fly    66 WWCGGSIIGNEWVLTAAHCT----DGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESY----LA 122
            :.||.:||.|...||||||.    ...:.||:|.|:|..:|......|.|  ...|.:|    ..
Mosquito    60 FDCGATIITNSHSLTAAHCVYKYPSDPSRVTLYGGSTSTSSGGIEVPVVS--IALHPNYNRKGFP 122

  Fly   123 LTIRNDISLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDL 187
            .....|::::.....|||...|...|...:|....  |......|||.|.....|....|:|.::
Mosquito   123 AASDCDVAVLTVPVNSFSGRPNMAPLALQTNELPV--GTECFVIGWGRTGYNQPASVNQLRYANM 185

  Fly   188 TIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGVLIGATSFGSADGCESGAPA 252
            .|:|.|.|...:..  ....::|....|...||.|||||.|...|.|.|..|| |...|.|..||
Mosquito   186 NIVSQSTCATIWAE--YRKFMICAKYNNGVDTCGGDSGGALVCGGGLAGVVSF-SHPNCTSAWPA 247

  Fly   253 AFTRIT--YYRDWIKETSGI 270
            .|.:||  ..|.:|::.:.|
Mosquito   248 GFAKITAPSIRSFIRQYAEI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 72/234 (31%)
Tryp_SPc 40..267 CDD:238113 72/236 (31%)
AgaP_AGAP012670XP_307656.4 Tryp_SPc 36..254 CDD:214473 70/227 (31%)
Tryp_SPc 37..263 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.