DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and SYG1

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_012217.3 Gene:SYG1 SGDID:S000001309 Length:902 Species:Saccharomyces cerevisiae

Alignment Length:871 Identity:208/872 (24%)
Similarity:323/872 (37%) Gaps:302/872 (35%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYE-------EMKAMLYAAIEQS-------PSAEL---------- 41
            ||||:|||....||||.:||:|:       ..|..|.|..|||       ||..:          
Yeast     1 MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAFQQREP 65

  Fly    42 ---------------------VEREMVTRYFAKFDEEFFHYCDKELAKINTFYSEKMAEATRKYG 85
                                 ::||.|    |.|.|::.  ...:|:|.|.||...:.|..:|:.
Yeast    66 GKSRSDGDYRSGPAFKKDYSALQREFV----ADFIEDWL--ISFQLSKCNEFYLWLLKECDKKFE 124

  Fly    86 SLRSEL------------------------TEALEMG---------------------------- 98
            .|:|:|                        |.....|                            
Yeast   125 VLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSVMYGSMPCTK 189

  Fly    99 HPKK------------------LPAWKRR------------TPLGKK-------------NVPAR 120
            ..||                  ||:|.:|            :..|::             ...||
Yeast   190 EAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFAFGASFLETMTTTQAR 254

  Fly   121 KIQDLKLAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAA--HFYTNK 183
            .:  |..|..|:||.|.|:::::::|.|||||::||.||...    .|..|..:..|  |:...|
Yeast   255 NL--LSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCH----TRELTTFMSYARTHYTLFK 313

  Fly   184 DIDRLIQETEQAV----------TQDIEGGDRQR------------------------------A 208
            ..|..:|...|.:          |.::....|.:                              .
Yeast   314 HADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITEWFTTALTNSPKDRKHNTHK 378

  Fly   209 MKRLRVP-PLGEQ------QSPWTTFKVGLFSGAFVVLFITVVIAAMFYGFGENWRAGMRMFRAP 266
            :|:|.:. .:.||      :|......|||..|    :.:|::...::.|......:.......|
Yeast   379 LKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIG----VSMTLITYTLYLGISSEETSFTHKILFP 439

  Fly   267 -----FLIIECLFLWGVNVYGWRSSGVNH--VLIFELDPRNHLSEQNIMEVAS---------VFG 315
                 ::::...||:.||.:.|..:|:|:  :::.|:..:|.....|.....|         .|.
Yeast   440 LWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSKNGTQFFNNDFATSKIPLKLYFLTFF 504

  Fly   316 VI--WACCVLSYIF--CDPLGIPQYAAPLCLYTLMAAFL-LNPT-------KTFHHEARFWAIRI 368
            ::  ..|.:||:..  ..|||.        ||..:.:|| |.|:       |..|  .|.|.:..
Yeast   505 IVPCAVCSMLSFALEKLTPLGF--------LYIGIVSFLFLCPSGLIPYWDKVVH--TRKWLVVT 559

  Fly   369 LIRVIMAPFCFVNFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHCVEYVSLLHP 433
            |||::|:.|..|.|.||:|.|.:.|:..:..||....|.:..:|. :..|.:.|..:..:|.|  
Yeast   560 LIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIAMFFCVYSHTPN-NLCGSSHSRAMGVLSCL-- 621

  Fly   434 IVAIMPAYFRFAQCIRRYRDTKESFPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLS-----KEN 493
                 |:|:||.||:||:.|:.:.||||:|||||....       .|:.|...|.||     :..
Yeast   622 -----PSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGI-------AYNATLCAYRLSDRSEQRRT 674

  Fly   494 PWFYCWITAAIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIV-------------YSSTWFYY 545
            |:..|    |..:|.....||:.|||....:....|..||:::.             :|....||
Yeast   675 PFIVC----ATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFSRKLVYY 735

  Fly   546 FGIIEDLILRFSW---TLSMSLIEAGYIEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFR 607
            |.:|.|:::||.|   .::...|:    :..|...||:.|||.|||:|..||:||||:.||..||
Yeast   736 FAMIWDILIRFEWIVYAIAPQTIQ----QSAVTSFILALLEVLRRFVWIIFRVENEHVANVHLFR 796

  Fly   608 AVRDISVAP------------MDCSD 621
            ...|   ||            ||.||
Yeast   797 VTGD---APLPYPIAQVGDDSMDSSD 819

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 64/297 (22%)
SPX 3..162 CDD:281146 64/299 (21%)
EXS 260..600 CDD:281164 110/389 (28%)
SYG1NP_012217.3 COG5408 1..310 CDD:227695 70/321 (22%)
SPX_SYG1_like 2..291 CDD:269896 64/297 (22%)
SPX 2..98 CDD:271919 27/100 (27%)
COG5409 402..803 CDD:227696 123/441 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 1 1.000 H134226
Inparanoid 1 1.050 210 1.000 Inparanoid score I800
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T634664
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 LDO PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.