DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and AT1G35350

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_174768.2 Gene:AT1G35350 AraportID:AT1G35350 Length:751 Species:Arabidopsis thaliana

Alignment Length:767 Identity:194/768 (25%)
Similarity:320/768 (42%) Gaps:185/768 (24%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAML---YAAIEQSPSAELVEREM------------VTRY 50
            |||.:...|.:.|||::.|::|..:|.:|   ..:.::|.|..:::|::            .:|.
plant     1 MKFGKEYVAQMIPEWQQAYMDYTCLKTILREIKTSQKRSESQGVLKRKLSGRRNFSGLTKRYSRT 65

  Fly    51 FAKFDEE-----------------------------------FFHYCDKELAKINTFYSEKMAEA 80
            |:..|.|                                   ||...|.|..|:|.||...:.|.
plant    66 FSSRDLENHDIMVHATTGDDGFEKYETTILKVSEVGRESELVFFKTLDLEFDKVNRFYRSNVEEL 130

  Fly    81 TRKYGSLRSEL--------------------------------------TEALEMG--------- 98
            .::...|..::                                      |.|.|||         
plant   131 VKEAVVLNRQMDALIAYRIKLDQPSTSWSCSETVSVDINALDSKEQKGKTLAEEMGIKVEENVSN 195

  Fly    99 --------HPKKLPAWKR-------RTPLG-----------------KKNVPARKIQD-LKLAFS 130
                    .|:.|....|       ..||.                 |:|:  :||:: ||..|.
plant   196 GGDSTKETAPEALSVLDRIRLNKNQENPLSTIRNVLKLSNKEDIKFTKENL--KKIEERLKNVFI 258

  Fly   131 EFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQETEQA 195
            |||..|..|:||..||.....||:||:|| :::...|:...:.|:.::..::.:|::|:...|..
plant   259 EFYRKLRHLKNYSFLNTLAISKIMKKYDK-IALRNAAKLYMEMVDKSYLTSSDEINKLMLRVESI 322

  Fly   196 VTQDIEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGAFVVLFITVVIAAMFYGFGEN--WRA 258
            ..:...|.:|.:.|..||  |...::....||..|.|.|..|    ::|||...:....|  ...
plant   323 FVEHFAGSNRSKGMNLLR--PKVTKEKHRITFSTGFFVGCTV----SLVIALGLFIHARNIMGAV 381

  Fly   259 GMRMFRAPFLIIECLF--------LWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFG 315
            |.:::......:..||        ::..|:|.|:...||:..||.......|...:::.::...|
plant   382 GHKLYMETMFPLYSLFAFVVLHMIMYASNIYFWKRYRVNYPFIFGFKEGTELGYGHVLLLSFGLG 446

  Fly   316 VIWACCVL--SYIFCDPLGIPQY-----AAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVI 373
            .:..|.||  ..:..|| ....|     ..||.:..|:.|..:.|...|:..:||:.:.:|.|.|
plant   447 TLALCAVLVNMDMEMDP-NTNDYKTITELVPLFVVALVIAISVCPFNIFYRSSRFFFLMVLFRCI 510

  Fly   374 MAPFCFVNFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHC--VEYVSLLHPIVA 436
            .||...||..||:|||||.|.|.|...:.|.||::|    |....:..|.|  .:..|..:.|||
plant   511 AAPLYKVNLPDFFLADQLTSQVQALRSLEFYICYYG----WGDFKQRQSTCKSSDVYSTFYFIVA 571

  Fly   437 IMPAYFRFAQCIRRY---RDTKESFPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLSKENPW-FY 497
            ::|.:.||.||:||.   :|..:.|    ||.||..:...|..       ...:.:::.|.| ..
plant   572 VIPYWSRFLQCVRRLIEEKDVSQGF----NALKYLLTIVAVCL-------RTAFSINRGNDWKIA 625

  Fly   498 CWITAAIFSSCYAYTWDIKMDWGLF--DSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTL 560
            .|:.:.: ::.|...|||..||||.  .||:    :|||:::......||..::.:::||.:|..
plant   626 AWVFSGL-ATFYGTYWDIVYDWGLLHRPSKS----WLREKLLVPHKSVYYVAMVVNVVLRLAWLQ 685

  Fly   561 SMSLIEAGYIEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDI 612
            ::......::..:.|:.:::.||:.||.|||:||||||||||||||||.:.:
plant   686 TVLDFNISFLHRETMVALIAILEIIRRGIWNFFRLENEHLNNVGKFRAFKSV 737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 58/287 (20%)
SPX 3..162 CDD:281146 58/289 (20%)
EXS 260..600 CDD:281164 103/363 (28%)
AT1G35350NP_174768.2 SPX_PHO1_like 2..295 CDD:269897 60/296 (20%)
SPX 3..300 CDD:281146 59/300 (20%)
EXS 391..725 CDD:281164 103/355 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.