DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and AT1G26730

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_173995.1 Gene:AT1G26730 AraportID:AT1G26730 Length:750 Species:Arabidopsis thaliana

Alignment Length:770 Identity:193/771 (25%)
Similarity:324/771 (42%) Gaps:173/771 (22%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAML---YAAIEQSPSAELVERE---------MVTRY--- 50
            |||.:.....:.|||::.|::|..:|::|   ..:.::|....:::|:         :..||   
plant     1 MKFGKDFVRQMIPEWQQAYMDYAGLKSILQEIQTSRKRSERPGILKRKLSGSRNFSGLTKRYSRT 65

  Fly    51 ---------------------FAKFDE--------------EFFHYCDKELAKINTFYSEKMAEA 80
                                 |.:::.              .||...|.|..|:|.||..|:.|.
plant    66 ASTREPEIQDILVHATTGDDGFERYETTILEVAEAGRESELAFFKTLDLEFDKVNHFYRSKVEEM 130

  Fly    81 TRKYGSLRSEL-------------------------------------TEALEMG---------- 98
            .::...|..::                                     |.|.|||          
plant   131 VKEAVVLNKQMDALIAFRIKVERPSSSWSCSETVSVDMNALDSNDQRNTLAEEMGIRVEGNGSNG 195

  Fly    99 -------HPKKLPAWKR-------RTPLGK-KNV--------------PARKIQD-LKLAFSEFY 133
                   .|:.|...:|       .|||.. |||              ..:||:: ||..|.|||
plant   196 GDSTKESVPQVLSVLERIRLNKTQETPLSTIKNVLKLSNQEELKFTRENLKKIEERLKNVFIEFY 260

  Fly   134 LGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQETEQAVTQ 198
            ..|..|:||..||.....||:||:||:.|.. .|:...:.|:.::..::.:|::|:...|....:
plant   261 RKLRHLKNYSFLNTLAISKIMKKYDKIASRS-AAKPYMEMVDKSYLTSSDEINKLMLRVESTFVE 324

  Fly   199 DIEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGAFVVLFITVVIAAMFYGFGEN--WRAGMR 261
            ...|.:|.:.|..||  |..:::....||..|.|.|..|    ::|:|.:.:....|  ...|.:
plant   325 HFAGLNRSKGMNLLR--PKVKKEKHRITFSTGFFVGCTV----SLVVALVMFIHARNIMGAVGHK 383

  Fly   262 MFRAPFLIIECLF--------LWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFGVIW 318
            ::......:..||        ::..|:|.|:...||:..||.......|..::::.::...|.:.
plant   384 VYMETMFPLYSLFAFVVLHMIMYASNIYFWKRYRVNYPFIFGFKEGTELGYRHVLLLSFGLGTLA 448

  Fly   319 ACCVLSYI--FCDPLGIPQYAA-----PLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAP 376
            .|.||..:  ..|| ....|..     |:.:..|:.|.|..|...|:..:|.:.:.::.|.|.||
plant   449 LCAVLINLDMEMDP-NTNDYKTMTELLPMFILALVVAILFCPFNIFYRSSRVFFLMVVFRCIAAP 512

  Fly   377 FCFVNFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHCVEYVSLLHPIVAIMPAY 441
            ...||..||:|||||.|.|.|...:.|.||::|.....|:.....|.  :..|..:.|||::|.:
plant   513 LYKVNLPDFFLADQLTSQVQALRSLEFYICYYGWGDFKHRQNTCRSS--DVYSTFYFIVAVIPYW 575

  Fly   442 FRFAQCIRRY---RDTKESFPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLSKENPW-FYCWITA 502
            .||.||:||.   .|:.:.:    ||.||..:...|..       ...|..::.|.| ...|:.:
plant   576 SRFLQCVRRLIEENDSSQGY----NALKYLLTVVAVCL-------RTAYSFNRGNIWKISAWVFS 629

  Fly   503 AIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSMSLIEA 567
            |: ::.|...|||..||||....:  ...|||:::......||..|:.:::||.:|..::.....
plant   630 AL-ATFYGTYWDIVFDWGLLHRPS--KHLLREKLLVPHKAVYYVAIVLNIVLRMAWLQTVLDFNL 691

  Fly   568 GYIEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQ 622
            .::..:.|:.:|:.||:.||.|||:||||||||||||||||.:.:.: |.:.:::
plant   692 SFLHRETMIALLAALEIIRRGIWNFFRLENEHLNNVGKFRAFKSVPL-PFNYNEE 745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 58/284 (20%)
SPX 3..162 CDD:281146 58/286 (20%)
EXS 260..600 CDD:281164 101/359 (28%)
AT1G26730NP_173995.1 SPX_PHO1_like 2..294 CDD:269897 61/293 (21%)
SPX 3..299 CDD:281146 60/297 (20%)
SPX <212..286 CDD:271919 26/74 (35%)
EXS 390..724 CDD:281164 101/351 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.