DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and SHB1

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_194265.2 Gene:SHB1 AraportID:AT4G25350 Length:745 Species:Arabidopsis thaliana

Alignment Length:757 Identity:187/758 (25%)
Similarity:317/758 (42%) Gaps:172/758 (23%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAML---YAAIEQS-----PSAELVEREMVTRY------- 50
            |:|.:...:.:.|||::.||:|..:|.:|   .|:..:|     .|.....|.:..||       
plant     1 MRFGKEFVSQMIPEWQEAYIDYAYLKTILQDIQASRNRSDSNNQSSTPSFARNLTRRYNRDALVS 65

  Fly    51 -------------------------FAK-------FDEEFFHYCDKELAKINTFY---------- 73
                                     |.|       |:..||...|:|..|:|.||          
plant    66 ENHDIVVNTVTRLEEGLETAAYETTFLKAGEAGGDFEVTFFRTLDREFNKVNNFYRLKVETARTE 130

  Fly    74 --------------SEKMAEATRKYGSLRSELTE-----ALEMGHPKK----------------- 102
                          ..|:.:..:|..|:...::|     |.|:|...|                 
plant   131 ALALNKQMDALIAFRHKVMDQNQKNPSVFDSVSEDINGSASEVGSSSKCTEHNVALADLMRNEDT 195

  Fly   103 ----------LPAWKRRTPLG--KKNVPARKIQDLK--------------LAFSEFYLGLILLQN 141
                      :...:..|||.  |..:...|..:||              :||.|||..|..|:|
plant   196 SNESILERIRMNKTREITPLSAIKTILKVHKQDELKFTRDNLKEVEKRLQVAFIEFYQKLRHLKN 260

  Fly   142 YQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQETEQAVTQDIEGGDRQ 206
            |..||.:...||:||:||:...: .|:...:.|:.:...:::::.:|:.:.|....:.....:|:
plant   261 YSFLNASAVSKIMKKYDKIAKRN-AAKLYMEMVDKSFLSSSEEVHKLLLKVESIFIEHFSNSNRR 324

  Fly   207 RAMKRLRVPPLGEQQSPWTTFKVGLFSGAFVVLFIT---VVIAAMFYGFGENWRAGMR------- 261
            ..|..|| |.:.:::. ..||..|.|.|..:.|.:.   ::.|....|     ..|.|       
plant   325 EGMSHLR-PKINKERH-LITFSTGFFFGCGISLIVALGLIIHARNIMG-----TPGQRTYMETMF 382

  Fly   262 -MFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFGVIWACCVL-- 323
             ::|....::..:.::..|:|.||...||:..||.......|..::::.::...|.:..|.||  
plant   383 PLYRFFGFVVLHMDVYAANIYFWRRYRVNYSFIFGFKQGTELGYRHVLLLSFGLGTLSLCAVLLN 447

  Fly   324 ----------SYIFCDPLGIPQYAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAPFC 378
                      .|.....|      .||.|..|:...:|.|....:..:||:.:.:|.|.|.|||.
plant   448 LDMEMDAQTKDYRLVTEL------IPLFLLVLVIIIVLCPFNILYRSSRFFFLSVLFRCIAAPFY 506

  Fly   379 FVNFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHCVEYVSLLHPIVAIMPAYFR 443
            .|:..||:|.|||.|.|.|...:.|.||::|.....::.....:..:.: ...:.|||::|.:.|
plant   507 AVHLPDFFLGDQLTSQVQALRSLEFYICYYGFGDFRYRRRNTCTSNIGF-RTFYFIVAVIPYWLR 570

  Fly   444 FAQCIRRYRDTKESFPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLSKENPWFYCWITAAIFS-- 506
            |.|||||..:.:: ..|..|..||    .:.|.|....|   .|.|::.:.|.   |||.:||  
plant   571 FLQCIRRMVEDRD-LSHGYNGIKY----LLTIVAASLRT---AYTLNRGSNWN---ITAWVFSGV 624

  Fly   507 -SCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSMSLIEAGYI 570
             :.|...|||.:||||. .:...|.|||::::......||..::.:::||..|..::..::..::
plant   625 ATFYGTYWDIVLDWGLL-QRGCKNSFLRDKLLVPHKTVYYAAMVLNVLLRLVWLQTVLDLKFSFL 688

  Fly   571 EGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDI 612
            ..:.|:.:::.||:.||.|||:||||||||||||::||.:.:
plant   689 HRETMVALMACLEIIRRGIWNFFRLENEHLNNVGRYRAFKTV 730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 57/276 (21%)
SPX 3..162 CDD:281146 58/278 (21%)
EXS 260..600 CDD:281164 103/363 (28%)
SHB1NP_194265.2 SPX_PHO1_like 2..286 CDD:269897 59/285 (21%)
SPX 3..291 CDD:281146 59/289 (20%)
EXS 382..718 CDD:281164 102/355 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.