DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and AT3G29060

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_189549.2 Gene:AT3G29060 AraportID:AT3G29060 Length:800 Species:Arabidopsis thaliana

Alignment Length:810 Identity:189/811 (23%)
Similarity:309/811 (38%) Gaps:221/811 (27%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAM------------------------------------- 28
            |||.......:..||::.|::|..:|::                                     
plant     1 MKFGREFETQMIQEWKEAYMDYRSLKSIVKQILRYRLQKQQRPPPPPPPPSTGDTVPLKTDGGEG 65

  Fly    29 ----------------LYAAI-------EQSPSAE------------------------------ 40
                            ||.|.       .:||...                              
plant    66 GGGGGGGGPGLSRRISLYRAFSGLTNRASRSPKKSHKHHNPLSSKRHHHHHNHHHYHLFDDDEEQ 130

  Fly    41 --LVEREMVTRYFAKF----------DEEFFHYCDKELAKINTFYSEKMAEATRKYGSLRSELTE 93
              |:..:....|...|          :.:||...|.|..|:..||.:|:.....:...|..:|..
plant   131 IILINEDETASYTTTFLNSAEEGGEMEVQFFRRLDGEFNKVLRFYKQKVENVMEEADELSRQLNV 195

  Fly    94 AL------EMGH---PKKL---------PAWKRRTPLGK-----------------KNVPARKIQ 123
            .:      |..|   |..|         |....|||...                 |..|...:.
plant   196 LIALRVKVENPHVHLPPDLNSVASAPSSPHSTMRTPAPSPMDVIREMEKTEDKKVFKPAPVEMLD 260

  Fly   124 DLKL--------------------------------------AFSEFYLGLILLQNYQNLNFTGF 150
            .:||                                      ||.|||..|..|::|..||...|
plant   261 HVKLKIDPETPLLTLKMMILGLPSEQTFSKPELRRAEELMNRAFVEFYQKLRFLKSYCFLNQLAF 325

  Fly   151 RKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQETEQAVTQDIEGGDRQRAMKRLRVP 215
            .|||||:||..|.: .::...:.|:.::..:..::.||:...|....:....|:.:..||.||  
plant   326 AKILKKYDKTTSRN-ASKPYLNTVDHSYLGSCDEVSRLMSRVEATFIKHFANGNHREGMKCLR-- 387

  Fly   216 PLGEQQSPWTTFKVGLFSGAFVVLFITVVIAAMFYG---------FGENWRAGMRMFRAPFLIIE 271
            |..:::....|:.:|.|||..|.|.|.:.:.....|         :.||......:|  .|:.:.
plant   388 PKTKREKHRITYFLGFFSGCAVALAIAITVLVHIRGLTKSEGRHQYMENIFPLYSLF--GFVAVH 450

  Fly   272 CLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFGVIWACCVLSYI--FCDP---- 330
             ||::..::|.|....||:..||..:..|.|..:.::.|.|...|:....|:|.:  ..||    
plant   451 -LFMYAADIYFWSRYRVNYPFIFGFEQGNDLGYREVLLVGSGLAVLTFGGVISNLDMEMDPRTKS 514

  Fly   331 LGIPQYAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAPFCFVNFADFWLADQLNSMV 395
            ..:.....||.|...:...|..|....:..:|::.:..:.|.:::|...|...||:|||||.|.|
plant   515 FSVITELVPLALLVCLMMVLFCPFNIIYRSSRYFFVGSVFRCLLSPLYKVILPDFFLADQLTSQV 579

  Fly   396 PAFLDIPFLICFFGRSPTWHKAGKAASH-CV--EYVSLLHPIVAIMPAYFRFAQCIRRYRDTKES 457
            ..|..:.|.:|::|    |....|..:| |.  |....|:.:|||:|.:|||||.|||..:.|:.
plant   580 QTFRSLLFYVCYYG----WGGDFKRRTHTCYDSEIYKELYLVVAIIPYWFRFAQSIRRLVEEKDK 640

  Fly   458 FPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLSKENPWFYCWITAAIFSSCYAYT----WDIKMD 518
            . |.:||.||.::...|.....:.....||           |:|.|:.:|..|..    |||..|
plant   641 M-HGLNALKYLSTILAVAARTIFEMKRGTY-----------WLTVAVTTSSIATLFNTYWDIFRD 693

  Fly   519 WGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLS-MSLIEAGYIEGDVMMTILSPL 582
            |||. ::...|.:||::::......|:..::.:::||.:|..: :.:.||.::....::.:::.|
plant   694 WGLM-NRNSKNPWLRDKLLVPYKSIYFIVMVANVVLRLAWMQTVLGIKEAPFLHKRALVAVVASL 757

  Fly   583 EVFRRFIWNYFRLENEHLNNVGKFRAVRDI 612
            |:.||.|||:|||||||||||||:||.:.:
plant   758 EIVRRGIWNFFRLENEHLNNVGKYRAFKSV 787

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 54/332 (16%)
SPX 3..162 CDD:281146 54/334 (16%)
EXS 260..600 CDD:281164 103/354 (29%)
AT3G29060NP_189549.2 COG5408 1..339 CDD:227695 57/338 (17%)
SPX_PHO1_like 2..342 CDD:269897 56/341 (16%)
EXS 438..775 CDD:281164 103/357 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 LDO PTHR10783
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.