DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and PHO1

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_188985.2 Gene:PHO1 AraportID:AT3G23430 Length:782 Species:Arabidopsis thaliana

Alignment Length:794 Identity:195/795 (25%)
Similarity:329/795 (41%) Gaps:194/795 (24%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAM---LYAAIEQSPSA----------------------- 39
            :||::.|.|.:.|||::.::||..:|..   :..:.:..|::                       
plant     2 VKFSKELEAQLIPEWKEAFVNYCLLKKQIKKIKTSRKPKPASHYPIGHHSDFGRSLFDPVRKLAR 66

  Fly    40 --------------------------------ELVEREMVTRYFAKFDE--EFFHYCDKELAKIN 70
                                            |:.:.|:| :.|::.||  .||...|:||.|:|
plant    67 TFSDKLFSNSEKPEILQVRRRRGSSETGDDVDEIYQTELV-QLFSEEDEVKVFFARLDEELNKVN 130

  Fly    71 TFYSEKMAEATRKYGSLRSELTEALEM--------------------------------GHPKKL 103
            .|:..|..|...:...|:.:|....|:                                |.|.:|
plant   131 QFHKPKETEFLERGEILKKQLETLAELKQILSDRKKRNLSGSNSHRSFSSSVRNSDFSAGSPGEL 195

  Fly   104 --------------------------PAWKRRTPLGKK------NVP----------ARKI---- 122
                                      .|.:.:|..||.      ::|          ||.|    
plant   196 SEIQSETSRTDEIIEALERNGVSFINSATRSKTKGGKPKMSLRVDIPDAVAGAEGGIARSIATAM 260

  Fly   123 -------------------------QDLKLAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLS 162
                                     :.::.||.|.|.||.||:.|.:||...|.||:||.||:..
plant   261 SVLWEELVNNPRSDFTNWKNIQSAEKKIRSAFVELYRGLGLLKTYSSLNMIAFTKIMKKFDKVAG 325

  Fly   163 VDYGARWRTDHVEAAHFYTNKDIDRLIQETEQAVTQDIEGGDRQRAMKRLRVPPLGEQQSPWTTF 227
            .:..:.: ...|:.:.|.::..:.||:.|.|...|:.....||::|||.|:  |...:.|...||
plant   326 QNASSTY-LKVVKRSQFISSDKVVRLMDEVESIFTKHFANNDRKKAMKFLK--PHQTKDSHMVTF 387

  Fly   228 KVGLFSGAFVVLFITVVIAAMFYG-FGENWRAG-----MRMFRAPFLIIECLFLWGVNVYGWRSS 286
            .||||:|.|:.||:..:|.|...| |..:.:..     ..:|....|:...:|::|.|:|.|:::
plant   388 FVGLFTGCFISLFVIYIILAHLSGIFTSSDQVSYLETVYPVFSVFALLSLHMFMYGCNLYMWKNT 452

  Fly   287 GVNHVLIFELDPRNHLSEQNIMEVASVF--GVIWACCVLSYIFCDPLGIPQY-AAPLCLYTLMAA 348
            .:|:..|||..|...|..::...:.:.|  .|:.|..:...:........|. ..|..|..:...
plant   453 RINYTFIFEFAPNTALRYRDAFLMGTTFMTSVVAAMVIHLILRASGFSASQVDTIPGILLLIFIC 517

  Fly   349 FLLNPTKTFHHEARFWAIRILIRVIMAPFCFVNFADFWLADQLNSMVPAFLDIPFLICFF-GRSP 412
            .|:.|..||:...||..||||.:::.:||..|...||::.|||.|.:|....:....|:| .:|.
plant   518 VLICPFNTFYRPTRFCFIRILRKIVCSPFYKVLMVDFFMGDQLTSQIPLLRHLETTGCYFLAQSF 582

  Fly   413 TWHKAG--KAASHCVEYVSLLHPIVAIMPAYFRFAQCIRRYRDTKESFP-HLVNAAKYATSFFVV 474
            ..|:..  |...:..|:..|    ::.:|.::|..||:||:.|  ||.| ||:|..||.::....
plant   583 KTHEYNTCKNGRYYREFAYL----ISFLPYFWRAMQCVRRWWD--ESNPDHLINMGKYVSAMVAA 641

  Fly   475 IFAHKYHTTTDTYPLSKENPWFYCWITAAIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYS 539
                   ....||.....:.|....:.:::.::.|...||...||||.:.|: .|.:||:.:|..
plant   642 -------GVRITYARENNDLWLTMVLVSSVVATIYQLYWDFVKDWGLLNPKS-KNPWLRDNLVLR 698

  Fly   540 STWFYYFGIIEDLILRFSWTLSMSLIEAGYIEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVG 604
            :..|||..|..:|:||.:|..::.......::..::...|:.|||.||..||::|:|||||||||
plant   699 NKNFYYLSIALNLVLRVAWIETIMRFRVSPVQSHLLDFFLASLEVIRRGHWNFYRVENEHLNNVG 763

  Fly   605 KFRAVRDISVAPMD 618
            :||||:.:.:..:|
plant   764 QFRAVKTVPLPFLD 777

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 58/320 (18%)
SPX 3..162 CDD:281146 58/322 (18%)
EXS 260..600 CDD:281164 97/347 (28%)
PHO1NP_188985.2 COG5408 3..336 CDD:227695 59/335 (18%)
SPX_PHO1_like 3..330 CDD:269897 59/328 (18%)
Peptidases_S8_S53 <191..>278 CDD:299169 10/87 (11%)
EXS 426..759 CDD:281164 97/347 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.