DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and AT2G03260

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_178425.2 Gene:AT2G03260 AraportID:AT2G03260 Length:807 Species:Arabidopsis thaliana

Alignment Length:849 Identity:188/850 (22%)
Similarity:322/850 (38%) Gaps:259/850 (30%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIE------------QSPSAELVEREMV------ 47
            |||.:.|::.:..||::.|:||:.:|.:|...|:            .:...|.:.|:|.      
plant     1 MKFGKELSSQMVQEWQQAYVNYDYLKTLLKEIIKLKEKTNPPPPPHHAVPGEGISRKMTLYRAFS 65

  Fly    48 ---------------TRYFAKFDEE--------------------------------FFHYCDKE 65
                           :.|.::.|.|                                ||...|.|
plant    66 GLVQTPGKKRQSSRQSNYSSEIDIEEGKAPILVSKSTHGLETTFLMTAEEGGEYELVFFRRLDDE 130

  Fly    66 LAKINTFYSEKMAEATR------------------------------------------------ 82
            ..::..||.||:.|..:                                                
plant   131 FNRVEKFYKEKVEEVMKDAIMLNKQMDALIAFRVKVENPVGWGWEERTVEMTRLASDIATSTAAI 195

  Fly    83 ----------------------------------KYGSLRS---------------------ELT 92
                                              .:||:|.                     |:.
plant   196 AASTPARTRTMNPRAQAHMEAIQEGSFSRENEDEDHGSVRGATGDVKTSSLNTMRGARPAPIEVL 260

  Fly    93 EALEMGHPKKLPAWKRRTPLGKKNVPAR-----------KIQD-LKLAFSEFYLGLILLQNYQNL 145
            :.:::.:.|..|   |.|..|..|..::           :::: ||.||.|||..|.||::|..|
plant   261 DHIKINNTKATP---RSTIKGVLNSSSQNEIIFNRQNLNEVEEKLKFAFVEFYQKLRLLKSYSFL 322

  Fly   146 NFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQETEQAVTQDIEGGDRQRAMK 210
            |...|.|||||:||:.|.: .::.....|:.::..::.::.:|||..|....:....|.|::.|.
plant   323 NVLAFSKILKKYDKITSRN-ASKSYMKMVDNSYLGSSDELMKLIQRVESTFIKHFANGHRRKGMN 386

  Fly   211 RLRVPPLGEQQSPWTTFKVGLFSGAFVVLFITVV-----------------IAAMF-----YGFG 253
            .||  |..:::....||..|..:|....|.:.:|                 :..||     :|| 
plant   387 ILR--PQMKREKHRVTFSTGFSAGCIFSLIVALVAIIRTRKTMPEAEHNTYMNTMFPLYSLFGF- 448

  Fly   254 ENWRAGMRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFGVIW 318
                           |:..:.::.:::|.|:...||:..||.......|..:.::.:....|...
plant   449 ---------------IVLHITMYAIDIYYWKRYRVNYAFIFGCKQGTELGYRQVLFLGFTIGTFA 498

  Fly   319 ACCVLSYIFCDPLGIPQYAAPLC----LYTLMAAF--LLNPTKTFHHEARFWAIRILIRVIMAPF 377
            ..|||..:..:.....:...||.    |:.|:|.|  |:.|....:...||:.:..|:..:.||.
plant   499 LLCVLGNLDMEVNPKTKNFKPLTELLPLFLLVALFVVLIMPFHFLYRSTRFFFLTCLLHCLAAPL 563

  Fly   378 CFVNFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHCVE---YVSLLHPIVAIMP 439
            ..|...||:|.|||.|.|.|...|.|.||::|    |....|..:.|..   |:..|: |||.:|
plant   564 YKVTLPDFFLGDQLTSQVQALRSINFYICYYG----WGDFKKRQNTCEASEIYIYSLY-IVASLP 623

  Fly   440 AYFRFAQCIRRYRDTKESFPHLVNAAKYATSFFVVIF--AHKYHTTTDTYPLSKENPWFYCWITA 502
            ...|..||:||..: :.|.....|..||..:...|..  |:.|...      :.:||..:..:.|
plant   624 YLSRLLQCMRRMIE-ERSLDQGYNGVKYLLTVIAVSLRTAYGYEVK------NTKNPTSHLKVLA 681

  Fly   503 ---AIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSMSL 564
               :|.::.:...||...||||. :|...||:||::::......|:..:|.:::|||:|..::..
plant   682 GSSSILAAVFCTYWDFVHDWGLL-NKTSKNRWLRDKLLIPQKKVYFIAMILNVVLRFAWLQTILN 745

  Fly   565 IEAGYIEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQTTILRMM 629
            .|..::.....:.:::.||:.||.:||:||:|||||||||||||.:.:.: |.:..:.       
plant   746 FEFEFLHKQTTLAVVASLEIMRRGMWNFFRVENEHLNNVGKFRAFKSVPL-PFNYDED------- 802

  Fly   630 DETD 633
            ||.|
plant   803 DEKD 806

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 56/337 (17%)
SPX 3..162 CDD:281146 56/339 (17%)
EXS 260..600 CDD:281164 95/354 (27%)
AT2G03260NP_178425.2 SPX_PHO1_like 2..344 CDD:269897 58/346 (17%)
SPX 3..349 CDD:281146 57/350 (16%)
EXS 440..781 CDD:281164 98/370 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.