DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and AT2G03240

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_178423.5 Gene:AT2G03240 AraportID:AT2G03240 Length:823 Species:Arabidopsis thaliana

Alignment Length:846 Identity:196/847 (23%)
Similarity:316/847 (37%) Gaps:271/847 (32%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAI----EQSPSA------ELVEREMVTR------ 49
            |||.:..::.:.|||.:.|::|:.:|:.|...|    :.:|..      .|:.|:|...      
plant     1 MKFGKEFSSQMVPEWHEAYMDYDYLKSQLKEIIKFKRKTNPHGPHHHHHHLLHRKMTLHRAFSGL 65

  Fly    50 ------------------------YFAKFDEE--------------------------------- 57
                                    :|:..|::                                 
plant    66 ISTSPKKKKHHGHGGGHGGGHQIGHFSDSDDDIEEGIKHVTAPILINSASHGYETTFLMASEEGG 130

  Fly    58 -----FFHYCDKELAKINTFYSEKMAEATRKYGSLRSELTEAL-----EMGHPKKLPAWKRR--- 109
                 ||...|.|..|:..||.||:.|..::...|..:: :||     ::.||...| |:.|   
plant   131 EYETVFFRRLDDEFNKVEKFYKEKVEEVMKEAVMLEKQM-DALIAFRVKVEHPDGWP-WEERTVE 193

  Fly   110 ------------------TPLGKKNVPA------------------------------------- 119
                              ||.|.:::..                                     
plant   194 MTQLASDVANSAAAVAASTPAGARSMKVGAQAHMEAIQEGGSSKAGKSSDEEDDDDAEKEEDNGV 258

  Fly   120 ---------------------------------------------------------RKIQ-DLK 126
                                                                     ||:: .|:
plant   259 SGEVSGDVRKMKAGRPPPIEVLDRVKFNHTKETPRSTIKSVLQASNLTELKFSRENLRKVEAKLR 323

  Fly   127 LAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQE 191
            .||.|||..|.||::|..||...|.|||||:||:.| .:.::.....::.::..::.::.||::.
plant   324 RAFVEFYQKLRLLKSYSFLNELAFSKILKKYDKITS-RHASKSYMKMIDNSYLGSSDEVTRLVER 387

  Fly   192 TEQAVTQDIEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGAF----VVLFITV--------- 243
            .|....:.....:|.:.|..||  |..:::....||..|...|..    |.||..:         
plant   388 VEATFIKHFSNANRSKGMNILR--PKAKRERHRITFSTGFLGGCLFSLVVALFAIIRTRNILQEE 450

  Fly   244 -------VIAAMFYGFGENWRAGMRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNH 301
                   .:..::..||             |:::..|...| |:|.||...||:..||.......
plant   451 GQKQYMNTMFPLYSLFG-------------FVVLHILMYAG-NIYYWRRYRVNYSFIFGFKHGTE 501

  Fly   302 LSEQNIMEVASVFGVIWACCVLSYI--FCDPLGIPQYAA-----PLCLYTLMAAFLLNPTKTFHH 359
            |..:.::.|....||....|:|:.:  ..|| ....|.|     ||.|.|.|...|:.|...|:.
plant   502 LGYRQVLFVGLSIGVFALLCILANLDMEVDP-ETKDYQALTELLPLFLLTGMFVVLVLPFNIFYR 565

  Fly   360 EARFWAIRILIRVIMAPFCFVNFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHC 424
            .:||:.:..|...:.||...|...||.:.|||.|.|.|...|.|.||.:|    |.......:.|
plant   566 SSRFFFLTCLFHCLAAPLYKVTLPDFLVGDQLTSQVQALRSIQFYICHYG----WGDYKHRINTC 626

  Fly   425 VE---YVSLLHPIVAIMPAYFRFAQCIRRYRDTKESFPHL-VNAAKYATSFFVVIFAHKYHTTTD 485
            .|   |.:.|. |||::|...|..||:||..:.|.  |.. .|..||    |:.|.|....|   
plant   627 TESDAYNAFLF-IVAVIPYVSRLLQCLRRLFEEKN--PEQGYNGLKY----FLTIVAVCLRT--- 681

  Fly   486 TYPLSKENPWFYCW-ITAAIFS---SCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYF 546
            ||.:.::|.  :.| |.|.|||   :.:...||:..||||. ::...|.:||::::......|:.
plant   682 TYSVDEDNQ--FIWRILAGIFSAIAAIFCTYWDLVYDWGLL-NRTSKNPWLRDKLLVPQKKVYFI 743

  Fly   547 GIIEDLILRFSWTLSMSLIEAGYIEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRD 611
            .:|.:::|||:|..::......::....|:.:::.||:.||.|||:|||||||||||||:||.:.
plant   744 AMILNILLRFAWLQTVLDFNFSFMHRQTMVAVVASLEIIRRGIWNFFRLENEHLNNVGKYRAFKT 808

  Fly   612 I 612
            :
plant   809 V 809

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 58/356 (16%)
SPX 3..162 CDD:281146 58/358 (16%)
EXS 260..600 CDD:281164 110/355 (31%)
AT2G03240NP_178423.5 SPX_PHO1_like 2..364 CDD:269897 60/365 (16%)
SPX 3..369 CDD:281146 59/369 (16%)
SPX <286..356 CDD:271919 21/70 (30%)
EXS 460..797 CDD:281164 112/369 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.