DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and xpr1b

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001119862.1 Gene:xpr1b ZFINID:ZDB-GENE-060503-266 Length:693 Species:Danio rerio

Alignment Length:679 Identity:362/680 (53%)
Similarity:466/680 (69%) Gaps:42/680 (6%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIEQSPSAELVEREMVTRYFAKFDEEFFHYCDKE 65
            |||.|||:||||||||||||.||..|.|||:|.:|:||.|:.:.:.|.||:|||:|:||..|:||
Zfish     1 MKFTEHLSAHITPEWRKQYIQYEAFKEMLYSAQDQAPSIEVTDEDTVKRYYAKFEEKFFQTCEKE 65

  Fly    66 LAKINTFYSEKMAEATRKYGSLRSELTEALEMGHPKKLPAW--KRRTPL---GKKNVPARKIQDL 125
            |||||||||||:|||.|::.:|::||..:|:........|.  .|||..   .::....|.|:||
Zfish    66 LAKINTFYSEKLAEAQRRFATLQNELQSSLDAQRESSRAAGLRHRRTVFHLSQQERCKHRNIKDL 130

  Fly   126 KLAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQ 190
            :||||||||.||||||||||||||||||||||||:.....||.||..|||.|.|||.|.|.:||.
Zfish   131 QLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKIFETSRGADWRVAHVEVAPFYTCKKITQLIS 195

  Fly   191 ETEQAVTQDIEGGDRQRAMKRLRVPPLG-EQQSP-WTTFKVGLFSGAFVVLFITVVIAA---MFY 250
            |||..||.::||||||:||||||||||| .|.:| ||||:|||:.|.||.|.:||:||.   :..
Zfish   196 ETETLVTTELEGGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGVFVALTVTVIIAGVVKLVE 260

  Fly   251 GFGEN---WRAGMRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVAS 312
            .||:|   |.. :|::|..||:||.|||.|:|.||||.:||||||||||:|||:||.|::.|:|.
Zfish   261 HFGDNTDVWPL-IRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEIAG 324

  Fly   313 VFGVIWACCVLSYIFCDPLGIPQYAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAPF 377
            ..||:|...:||.:|.:...||.:..||.||.....||:||.||.::::|||.:::|.||:.|||
Zfish   325 FLGVLWCVSILSCLFAENTLIPIHMNPLALYGFFFLFLINPLKTCYYKSRFWLLKLLFRVVTAPF 389

  Fly   378 CFVNFADFWLADQLNSMVPAFLDIPFLICFF--------GRSPTWHKAGKAASHCVEYVSLLHPI 434
            ..|.||||||||||||:|...:|:.::|||:        .....|.|.|:..  |..|...:..:
Zfish   390 HRVGFADFWLADQLNSLVVVLMDLEYMICFYSLELNWTMSEGELWIKEGERI--CYSYSYGVRAV 452

  Fly   435 VAIMPAYFRFAQCIRRYRDTKESFPHLVNAAKYATSFFVVIF--AHKYHTTTDTYPLSKENPWFY 497
            :..:||:|||.||:|||||||.:|||||||.||:|:||||||  ..|.|:..:.:      .:.|
Zfish   453 IKCLPAWFRFVQCLRRYRDTKRAFPHLVNAGKYSTTFFVVIFEALFKTHSGDERF------VFLY 511

  Fly   498 CWITAAIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSM 562
            ..|...|.:|||...||:||||||||..||:|..|||||||....:||..|:||:||||:||:.:
Zfish   512 IMIACRIVNSCYTLLWDLKMDWGLFDRNAGENTLLREEIVYPQKAYYYCAIVEDVILRFAWTIPL 576

  Fly   563 SLIEAGY---IEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQTT 624
            || |..|   :..:::.|:|.||||||||:||:||||||||||.|:|||||||||||::..|||.
Zfish   577 SL-EVVYDRPVISNILGTVLPPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTL 640

  Fly   625 ILRMMDETDGVLNRRRGKAAGGKSATKKN 653
            :.:|||:.|||.||.      ||...|::
Zfish   641 LEQMMDQEDGVRNRL------GKKNWKRS 663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 98/162 (60%)
SPX 3..162 CDD:281146 98/164 (60%)
EXS 260..600 CDD:281164 175/353 (50%)
xpr1bNP_001119862.1 SPX_XPR1_like 2..164 CDD:269898 98/162 (60%)
SPX 3..172 CDD:281146 99/169 (59%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 157..164 7/7 (100%)
EXS 289..616 CDD:281164 166/336 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196187637
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 740 1.000 Inparanoid score I560
OMA 1 1.010
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T128810
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.