DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and CG7536

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster

Alignment Length:672 Identity:419/673 (62%)
Similarity:509/673 (76%) Gaps:10/673 (1%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIEQSPSAELVEREMVTRYFAKFDEEFFHYCDKE 65
            |||||||:||||||||||||||||||||||.|:|::||.|.||.:::.|:||.|||.||||||||
  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFANFDENFFHYCDKE 65

  Fly    66 LAKINTFYSEKMAEATRKYGSLRSELTEALEMGH--PKKLPAWKRRTPLGKKNVPARKIQDLKLA 128
            |.|||||||||:||||||:.:|.:||..::|...  .||....||...|     |.||.::||||
  Fly    66 LKKINTFYSEKLAEATRKFATLNAELKTSIEESERSAKKSKGHKRHAAL-----PDRKARELKLA 125

  Fly   129 FSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQETE 193
            ||||||.|||||||||||.||||||||||||||.||.||:||.::|||:||:||||||.:|.|||
  Fly   126 FSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDIDNIINETE 190

  Fly   194 QAVTQDIEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGAFVVLFITVVIAAMFYGF-GENWR 257
            ..||.::||||||||||||||||||||||||||||||||||:|:||.|.||::|:|:.. |||.:
  Fly   191 TTVTGELEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGSFIVLVIVVVVSAIFHEISGENLK 255

  Fly   258 AGMRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFGVIWACCV 322
            ...|::|.|.||||.:||.|||:|||||||||||||||||||||||||::||:|::|||||...:
  Fly   256 VTFRLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIFGVIWTLSM 320

  Fly   323 LSYIFCDPLGIPQYAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAPFCFVNFADFWL 387
            ||:::...|.||.:..||.|..:|..||.||....:|:||||..||..|.:.|||..|.||||||
  Fly   321 LSFLYSASLAIPAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFFHVGFADFWL 385

  Fly   388 ADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHCVEYVSLLHPIVAIMPAYFRFAQCIRRYR 452
            .|||||:..|.||..:||||:..:..|.:| :.||.|:|...::.|||..:||:||||||:||||
  Fly   386 GDQLNSLATAILDFEYLICFYFTNGNWTEA-RDASICMEKDFIIRPIVNCLPAWFRFAQCLRRYR 449

  Fly   453 DTKESFPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLSKENPWFYCWITAAIFSSCYAYTWDIKM 517
            |::|:|||||||.||:|:|.|||||......:..|..:.:||:.:.||.|:|.||||||||||||
  Fly   450 DSREAFPHLVNAGKYSTTFMVVIFATLKSFHSPNYASTFDNPYTWLWIIASIVSSCYAYTWDIKM 514

  Fly   518 DWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSMSLIEAGYIEGDVMMTILSPL 582
            ||||||..||:|.|||||:|||||.||||.|:|||.|||.|.||..|.|...:..|:|.::...|
  Fly   515 DWGLFDKNAGENTFLREEVVYSSTGFYYFAILEDLALRFIWALSFYLTEMKIVSSDIMTSVTGIL 579

  Fly   583 EVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQTTILRMMDETDGVLNRRRGKAAGGK 647
            ||||||:||:||||||||||.||||||||||:||:|.|||..|||:|||.|||:||.. ||...|
  Fly   580 EVFRRFVWNFFRLENEHLNNCGKFRAVRDISIAPLDSSDQALILRLMDEADGVINRYT-KANRPK 643

  Fly   648 SATKKNKQEQRLLLQGESIEDL 669
            ....|:.:::.||....|:.||
  Fly   644 PKKVKDPEKRSLLQTRGSLPDL 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 109/159 (69%)
SPX 3..162 CDD:281146 111/161 (69%)
EXS 260..600 CDD:281164 199/340 (59%)
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 109/159 (69%)
SPX 3..158 CDD:281146 110/160 (69%)
EXS 258..597 CDD:281164 199/340 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196152132
eggNOG 1 0.900 E1_COG5409
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 P PTHR10783
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
98.870

Return to query results.
Submit another query.