DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and Xpr1

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001099462.1 Gene:Xpr1 RGDID:1306554 Length:696 Species:Rattus norvegicus

Alignment Length:675 Identity:364/676 (54%)
Similarity:467/676 (69%) Gaps:47/676 (7%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIEQSPSAELVEREMVTRYFAKFDEEFFHYCDKE 65
            |||||||:||||||||||||.||..|.|||:|.:|:||.|:.:.:.|.||||||:|:||..|:||
  Rat     1 MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKE 65

  Fly    66 LAKINTFYSEKMAEATRKYGSLRSELTEALEMGHPKKLPAWK----------RRTPL----GKKN 116
            |||||||||||:|||.|::.:|::||..:|:        |.|          ||.|:    .::.
  Rat    66 LAKINTFYSEKLAEAQRRFATLQNELQSSLD--------AQKESTGVTTLRQRRKPVFHLSHEER 122

  Fly   117 VPARKIQDLKLAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYT 181
            |..|.|:|||||||||||.||||||||||||||||||||||||:|....||.||..|||.|.||.
  Rat   123 VQHRNIKDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHVEVAPFYI 187

  Fly   182 NKDIDRLIQETEQAVTQDIEGGDRQRAMKRLRVPPLG-EQQSP-WTTFKVGLFSGAFVVLFITVV 244
            .|.|::||.|||..||.::|.||||:||||||||||| .|.:| ||||:||||.|.|:||.||:|
  Rat   188 CKKINQLISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFFGIFIVLNITLV 252

  Fly   245 IAAMFYGFGEN--WRAGMRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNI 307
            .||:|....:.  |.. :|::|..||:||.|||.|:|.||||.:||||||||||:|||:||.|::
  Rat   253 FAAVFKLETDRTVWPL-IRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHL 316

  Fly   308 MEVASVFGVIWACCVLSYIFCDPLGIPQYAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRV 372
            .|:|...|::|...:|:..|.....||.|..||.||..|..||:||||||::::|||.:::|.||
  Rat   317 FEIAGFLGILWCLSLLACFFAPISIIPIYVYPLALYGFMVFFLINPTKTFYYKSRFWLLKLLFRV 381

  Fly   373 IMAPFCFVNFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKA-------GKAASHCVEYVSL 430
            ..|||..|.||||||||||||:....:|:.::|||:.....|.::       .:....|..|...
  Rat   382 FTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSFELKWDESKGLLPNDPQEPEFCHGYTYG 446

  Fly   431 LHPIVAIMPAYFRFAQCIRRYRDTKESFPHLVNAAKYATSFFVVIFA-----HKYHTTTDTYPLS 490
            :..||..:||:.||.||:||||||:.:|||||||.||:|:||.|.||     ||....:||.   
  Rat   447 VRAIVQCIPAWLRFIQCLRRYRDTRRAFPHLVNAGKYSTTFFTVTFAALYSTHKERGHSDTM--- 508

  Fly   491 KENPWFYCWITAAIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILR 555
               .:||.|:...|.||||...||:||||||||..||:|.||||||||....:||..|:||:|||
  Rat   509 ---VFFYLWVVFCIISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIVEDVILR 570

  Fly   556 FSWTLSMSLIEAGYIE--GDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMD 618
            |:||:.:|:....:..  ||::.|:.:||||||||:||:||||||||||.|:|||||||||||::
  Rat   571 FAWTIQISITATTFKPHVGDIIATVFAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLN 635

  Fly   619 CSDQTTILRMMDETDGVLNRRRGKA 643
            ..|||.:.:|||:.|||.||::.::
  Rat   636 ADDQTLLEQMMDQEDGVRNRQKSRS 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 103/171 (60%)
SPX 3..162 CDD:281146 104/173 (60%)
EXS 260..600 CDD:281164 176/354 (50%)
Xpr1NP_001099462.1 SPX_XPR1_like 2..165 CDD:269898 103/171 (60%)
SPX 3..169 CDD:281146 104/174 (60%)
EXS 286..617 CDD:281164 167/337 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 1 1.000 H134226
Inparanoid 1 1.050 739 1.000 Inparanoid score I550
OMA 1 1.010
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T618950
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 LDO PTHR10783
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.840

Return to query results.
Submit another query.