DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and SPAC1D4.05c

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_593018.1 Gene:SPAC1D4.05c PomBaseID:SPAC1D4.05c Length:387 Species:Schizosaccharomyces pombe

Alignment Length:396 Identity:86/397 (22%)
Similarity:152/397 (38%) Gaps:92/397 (23%)


  Fly   263 FRAPFLIIECLFLWGV----------------NVYGWRSSGVNHVLIFELDPRNHLSEQN----- 306
            ||...|:|...:||.|                |..|..:|...|:|...|..|:...|:|     
pombe    18 FRIGLLVIVGTWLWSVCYHLIYILNRYQPISPNPRGSLNSKWYHLLQIPLSNRHTDLEENTEFKA 82

  Fly   307 --IMEV--------ASVFGVIWACCVLSYI---FCDPLGIPQYAAPLC-LYTLMAAFLL--NPTK 355
              :..|        |::..:.||...:.::   ..|..|:  |:.|:. |..::.||:|  .|..
pombe    83 NLVSPVDFHAGYCFAAILSISWATGFILFLKKTQGDIGGL--YSHPIYPLLWVITAFILIVFPFP 145

  Fly   356 TFHHEARFWAIRILIRVIMAPFCFVN------FADFWLADQLNSMVPAFLDIPFLICFFGRSPTW 414
            ..:..::....:.:|||    |.|..      :.||.:::...|...|..|.....|..      
pombe   146 WRYRSSQRGLRKSIIRV----FLFFQADFRSPYKDFIVSEIFTSYAKALGDFYIFGCVL------ 200

  Fly   415 HKAGKAASHCVEYV---------SLLHPIVAIMPAYFRFAQCI-----RRYRDTKESFP-HLVNA 464
                  ..|..::.         :...|:....|......||:     ||    |.:|. :|::|
pombe   201 ------QGHISKFTLRPDLKCDGTFFVPLAMAYPFIVAILQCLHYGLSRR----KHTFKINLLSA 255

  Fly   465 AKYATSFFVVIFAHKYHTTTDTYPLSKENPW-FYCWITAAIFSSCYAYTWDIKMDWGL---FDSK 525
            .|:||:..|:..:...|.....:.|:..:.: |:.||.:|:.||.|.:.||:.:||.:   |...
pombe   256 LKHATALPVIYLSAIIHAKQTKFTLTSGHGYLFWLWILSALLSSAYTFLWDVFIDWRIRFPFHKS 320

  Fly   526 AGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSMSLIEAGYIEGDVMMTILSPLEVFRRFIW 590
            ....||        ..:.|..|...:.|||.:|::.:......:.|.::.:.....||:.|||:|
pombe   321 INHKRF--------PMFIYAIGCFINFILRVTWSMKLHPRLHQFHEYEMGIFSFEMLEILRRFLW 377

  Fly   591 NYFRLE 596
            .:|.|:
pombe   378 LFFHLD 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898
SPX 3..162 CDD:281146
EXS 260..600 CDD:281164 86/397 (22%)
SPAC1D4.05cNP_593018.1 COG5409 2..387 CDD:227696 86/397 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.