DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and SPAC227.01c

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_592955.2 Gene:SPAC227.01c PomBaseID:SPAC227.01c Length:373 Species:Schizosaccharomyces pombe

Alignment Length:261 Identity:70/262 (27%)
Similarity:113/262 (43%) Gaps:65/262 (25%)


  Fly   383 ADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKAGKAASHCVEYVS-LLHPIVAIMPAYFRFAQ 446
            ||.|||..             ::.:...||.       .||..:|.: ::..::|..|...||.|
pombe   157 ADLWLAGA-------------ILIYVTDSPN-------NSHRKQYENEVIMSMIAAYPYAIRFRQ 201

  Fly   447 CI--RRYRD-TKESFPHLVNAAKYATSF---FVVIFAHKYHTTTDTYPLSKENPWFYCWITAAIF 505
            |:  |...| :.:.|...:|:.||.|:|   |:.|||.|..:..          || .|.|::..
pombe   202 CLIERSSADNSSDKFWSTLNSIKYFTAFPAIFLGIFAKKRFSFL----------WF-LWNTSSAI 255

  Fly   506 SSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWF--------YYFGIIE--DLILRFSWTL 560
            :|.|::.||:.|||.|        .|.::.:...:..|        :.|.::.  |.:||.:|.:
pombe   256 NSTYSFWWDVSMDWSL--------PFFKQPLSIQNWKFGVRRLFPTFTFAVVSAIDFVLRMAWVV 312

  Fly   561 S-MSLIEAGYIEGDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQTT 624
            . :...::.:...|..:.|:..||||||.:|.:||:|.|    ..|..|..:||    |.||..|
pombe   313 RVLPEHQSAFFTTDFGIFIMQFLEVFRRCVWVFFRIEAE----ASKSLAYVNIS----DRSDIPT 369

  Fly   625 I 625
            |
pombe   370 I 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898
SPX 3..162 CDD:281146
EXS 260..600 CDD:281164 61/235 (26%)
SPAC227.01cNP_592955.2 EXS 15..351 CDD:281164 60/233 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.