DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and Xpr1

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_035403.1 Gene:Xpr1 MGIID:97932 Length:695 Species:Mus musculus

Alignment Length:667 Identity:364/668 (54%)
Similarity:470/668 (70%) Gaps:32/668 (5%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIEQSPSAELVEREMVTRYFAKFDEEFFHYCDKE 65
            |||||||:||||||||||||.||..|.|||:|.:|:||.|:.:.:.|.||||||:|:||..|:||
Mouse     1 MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKE 65

  Fly    66 LAKINTFYSEKMAEATRKYGSLRSELTEALEMGHPKK--LPAWKRRTPL----GKKNVPARKIQD 124
            |||||||||||:|||.|::.:|::||..:|::.....  ....:||.|:    .::.|..|.|:|
Mouse    66 LAKINTFYSEKLAEAQRRFATLQNELQSSLDVQKESSGVTTLRQRRKPVFHLSHEERVQHRNIKD 130

  Fly   125 LKLAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLI 189
            ||||||||||.||||||||||||||||||||||||:|....||.||..|||.|.|||.|.|::||
Mouse   131 LKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVIHVEVAPFYTCKKINQLI 195

  Fly   190 QETEQAVTQDIEGGDRQRAMKRLRVPPLG-EQQSP-WTTFKVGLFSGAFVVLFITVVIAAMFYGF 252
            .|||..||.::|.||||:||||||||||| .|.:| ||||:||||.|.|:||.||:|.||:|...
Mouse   196 SETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVFAAVFKLE 260

  Fly   253 GEN--WRAGMRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFG 315
            .:.  |.. :|::|..||:||.|||.|:|.||||.:||||||||||:|||:||.|::.|:|...|
Mouse   261 TDRTVWPL-IRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEIAGFLG 324

  Fly   316 VIWACCVLSYIFCDPLGIPQYAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAPFCFV 380
            ::|...:|:..|.....||.|..||.||..|..||:||||||::::|||.:::|.||..|||..|
Mouse   325 ILWCLSLLACFFAPISIIPIYVYPLALYGFMVFFLINPTKTFYYKSRFWLLKLLFRVFTAPFHKV 389

  Fly   381 NFADFWLADQLNSMVPAFLDIPFLICFFGRSPTWHKA-------GKAASHCVEYVSLLHPIVAIM 438
            .||||||||||||:....:|:.::|||:.....|.::       .:....|.:|...:..||..:
Mouse   390 GFADFWLADQLNSLSVILMDLEYMICFYSFELKWDESKGLLPNDPQEPEFCHKYSYGVRAIVQCI 454

  Fly   439 PAYFRFAQCIRRYRDTKESFPHLVNAAKYATSFFVVIFA-----HKYHTTTDTYPLSKENPWFYC 498
            ||:.||.||:||||||:.:|||||||.||:|:||.|.||     |:....:||.      .:||.
Mouse   455 PAWLRFIQCLRRYRDTRRAFPHLVNAGKYSTTFFTVTFAALYSTHEEQNHSDTV------VFFYL 513

  Fly   499 WITAAIFSSCYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSMS 563
            |:...|.||||...||:||||||||..||:|.||||||||....:||..||||:||||:||:.:|
Mouse   514 WVFFCIISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIIEDVILRFAWTIQIS 578

  Fly   564 LIEAGYIE--GDVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQTTIL 626
             |.|.:..  |:::.|:.:||||||||:||:||||||||||.|:|||||||||||::..|||.:.
Mouse   579 -ITATFKPHVGNIIATVFAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLE 642

  Fly   627 RMMDETDGVLNRRRGKA 643
            :|||:.|||.||::.::
Mouse   643 QMMDQEDGVRNRQKNRS 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 101/163 (62%)
SPX 3..162 CDD:281146 102/165 (62%)
EXS 260..600 CDD:281164 177/354 (50%)
Xpr1NP_035403.1 SPX_XPR1_like 2..165 CDD:269898 101/163 (62%)
SPX 3..169 CDD:281146 102/166 (61%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 158..165 7/7 (100%)
EXS 286..616 CDD:281164 168/337 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 1 1.000 H134226
Inparanoid 1 1.050 744 1.000 Inparanoid score I582
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T616836
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 LDO PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 1 0.960
1312.810

Return to query results.
Submit another query.