DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10483 and xpr1a

Sequence 1:NP_648000.1 Gene:CG10483 FlyBaseID:FBgn0035649 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001232029.1 Gene:xpr1a ZFINID:ZDB-GENE-060503-362 Length:692 Species:Danio rerio

Alignment Length:685 Identity:368/686 (54%)
Similarity:475/686 (69%) Gaps:24/686 (3%)


  Fly     1 MKFAEHLTAHITPEWRKQYINYEEMKAMLYAAIEQSPSAELVEREMVTRYFAKFDEEFFHYCDKE 65
            |||||||:||||||||||||.||..|.|||||.:|:||.|:.:.:.|.||:|||:|:||..|:||
Zfish     1 MKFAEHLSAHITPEWRKQYIQYEAFKEMLYAAQDQAPSLEVTDEDTVKRYYAKFEEKFFQTCEKE 65

  Fly    66 LAKINTFYSEKMAEATRKYGSLRSELTEALEMGHPKKLPAWKRR----TPL-GKKNVPARKIQDL 125
            |:|||||||||:|||.|::.:|::||..:|:.......||.:.|    .|| .|:....|.|:||
Zfish    66 LSKINTFYSEKLAEAQRRFATLQNELQTSLDAQRESNAPALRSRRKTVLPLSNKERNKHRNIKDL 130

  Fly   126 KLAFSEFYLGLILLQNYQNLNFTGFRKILKKHDKLLSVDYGARWRTDHVEAAHFYTNKDIDRLIQ 190
            :||||||||.||||||||||||||||||||||||:|....||.||..|||.|.|||.|.|.:||.
Zfish   131 QLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILDTPRGADWRVAHVEVAPFYTCKKITQLIS 195

  Fly   191 ETEQAVTQDIEGGDRQRAMKRLRVPPLG-EQQSP-WTTFKVGLFSGAFVVLFITVVIAAMFYGFG 253
            |||..||.::||||||:||||||||||| .|.:| ||||:|||:.|.|:||.:..|:...|:...
Zfish   196 ETEALVTTELEGGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGVFIVLAVAFVLTGAFFVRK 260

  Fly   254 ENWRAGMRMFRAPFLIIECLFLWGVNVYGWRSSGVNHVLIFELDPRNHLSEQNIMEVASVFGVIW 318
            :|....:|::|..||:::.|||.|:|.||||.:||||||||||:|||:||.|::.|:|...||:|
Zfish   261 QNIWPLVRIYRGGFLLVQFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEIAGFLGVLW 325

  Fly   319 ACCVLSYIFCDPLGIPQYAAPLCLYTLMAAFLLNPTKTFHHEARFWAIRILIRVIMAPFCFVNFA 383
            ...:||.:|.|...:|..|.||.||..|..||:||.||.::::|||.|::|.||..|||..|.||
Zfish   326 CLSILSCLFADYTWLPMQANPLILYGFMLLFLINPFKTAYYKSRFWLIKLLFRVFTAPFHRVEFA 390

  Fly   384 DFWLADQLNSMVPAFLDIPFLICFFGRSPTWHK------AGKAASHCVEYVSLLHPIVAIMPAYF 442
            ||||||||||:|....|:.:|:|::.....|.:      |......|..:...:..|:..:||:.
Zfish   391 DFWLADQLNSLVIVLSDLEYLVCYYSMELQWGERNGLLPAKFGDERCNSFSYGVRAIIHCLPAWL 455

  Fly   443 RFAQCIRRYRDTKESFPHLVNAAKYATSFFVVIFAHKYHTTTDTYPLSKENPWFYCWITAAIFSS 507
            ||.||:||||||:.:|||||||.||:|:||||.||..|.|..|......| .:||..:.::|.||
Zfish   456 RFVQCLRRYRDTRRAFPHLVNAGKYSTTFFVVTFAALYRTHKDQNHADSE-VFFYMLVLSSIVSS 519

  Fly   508 CYAYTWDIKMDWGLFDSKAGDNRFLREEIVYSSTWFYYFGIIEDLILRFSWTLSMSLIEAGYIEG 572
            .|...||:||||||||..||:|.||||||||....:||..||||::|||:|||.:||.....|..
Zfish   520 LYTLIWDLKMDWGLFDRNAGENTFLREEIVYPHKAYYYCAIIEDVLLRFAWTLQISLTSMTRIPS 584

  Fly   573 --DVMMTILSPLEVFRRFIWNYFRLENEHLNNVGKFRAVRDISVAPMDCSDQTTILRMMDETDGV 635
              |:::|||:||||||||:||:||||||||||.|:|||||||||||::..|||.:.:|||:.|||
Zfish   585 IEDIVVTILAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQEDGV 649

  Fly   636 LNRRRGKAAGGKSATKK--NKQEQRLLLQGESIED 668
            .||:      ||.:.|:  :...:|.||..:|.:|
Zfish   650 RNRQ------GKKSWKRSYSLSLRRPLLSSQSKKD 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10483NP_648000.1 SPX_XPR1_like 2..159 CDD:269898 101/162 (62%)
SPX 3..162 CDD:281146 102/164 (62%)
EXS 260..600 CDD:281164 177/348 (51%)
xpr1aNP_001232029.1 SPX_XPR1_like 2..164 CDD:269898 101/162 (62%)
SPX 3..169 CDD:281146 102/166 (61%)
EXS 284..614 CDD:281164 170/331 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 1 1.000 H134226
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T128810
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 LDO PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.