DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: QC and Qpct

Sequence 1:NP_729109.1 Gene:QC FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006239694.1 Gene:Qpct RGDID:1562284 Length:362 Species:Rattus norvegicus

Alignment Length:326 Identity:141/327 (43%)
Similarity:196/327 (60%) Gaps:30/327 (9%)


  Fly    20 PSH-------QQATAGNIGSQWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQ- 76
            |:|       |.|.|.:|...|::|       |..:|:.|..||.|....|::::|.:..|..: 
  Rat    46 PAHLNSSSLRQVAEATSISEMWQND-------LRPLLIERYPGSPGSYSARQHIMQRIQRLQAEW 103

  Fly    77 -TEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFP--NDPGFVGATDSAVPCAI 138
             .|||.|..|.| :|..:|:|::.|:||:|:..|.|||||||||||  :...||||||||||||:
  Rat   104 VVEVDTFLSRTP-YGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPQWDSRVFVGATDSAVPCAM 167

  Fly   139 LLNTAKTLGAYLQ--KEFR-NRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASK--RSG 198
            :|..|:.|...|.  |:.. :|.|:.|.||||||||||..|:..||:|||:|||.|:||.  ..|
  Rat   168 MLELARALDKKLHSLKDVSGSRPDLSLRLIFFDGEEAFLHWSPQDSLYGSRHLAQKMASSPHPPG 232

  Fly   199 SQAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNN---NM 260
            |:   ....:|.:::|||||||||.||.|.:|:..|....:.|..||:.|...|.|:.::   ..
  Rat   233 SR---GTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFTRLQAIEQQLSELGLLKDHSLERKY 294

  Fly   261 FLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQY 325
            |.:...|.::.|||.|||.:.||||||:|:|||:||||..||..|||..:|.|.|::.:.||.:|
  Rat   295 FQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHSSTIDNLNKIIQVFVLEY 359

  Fly   326 L 326
            |
  Rat   360 L 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 132/301 (44%)
QpctXP_006239694.1 M28_QC_like 65..359 CDD:193501 133/305 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262760517
eggNOG 1 0.900 E1_KOG3946
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1257754at2759
OrthoFinder 1 1.000 FOG0000952
OrthoInspector 1 1.000 T131226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12283
Phylome 1 0.910 0.625 Consistency score
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.