DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: QC and QPCT

Sequence 1:NP_729109.1 Gene:QC FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_036545.1 Gene:QPCT HGNCID:9753 Length:361 Species:Homo sapiens

Alignment Length:320 Identity:134/321 (42%)
Similarity:187/321 (58%) Gaps:31/321 (10%)


  Fly    23 QQATAGNIGSQWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGL--GFQTEVDEFKQR 85
            |.|...:|...|::|       |..:|:.|..||.|....|::::|.:..|  .:..|:|.|..:
Human    55 QIAEGTSISEMWQND-------LQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQ 112

  Fly    86 VPVFGELTFANVVGTINPQAQNFLALACHYDSKYFP--NDPGFVGATDSAVPCAILLNTAKTLG- 147
            .| :|..:|:|::.|:||.|:..|.||||||||||.  |:..||||||||||||::|..|:.|. 
Human   113 TP-YGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDK 176

  Fly   148 --AYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLAS------KRSGSQAQLA 204
              ..|:....::.|:.|.||||||||||..|:..||:|||:|||||:||      .|..||    
Human   177 KLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQ---- 237

  Fly   205 PRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNN---NMFLSRVS 266
               :..:::|||||||||.||.|.:|:.|:......|..||..|...|.|:.::   ..|.:...
Human   238 ---LHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSY 299

  Fly   267 GGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYL 326
            ||::.|||.|||...||||||:.:|||:||||..||..||...:|.|.|::.:.||.:||
Human   300 GGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 128/305 (42%)
QPCTNP_036545.1 M28_QC_like 51..358 CDD:193501 132/318 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262778031
eggNOG 1 0.900 E1_KOG3946
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.861353 Normalized mean entropy S1680
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1257754at2759
OrthoFinder 1 1.000 FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129821
Panther 1 1.100 LDO PTHR12283
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.660

Return to query results.
Submit another query.